TERF2IP

білок-кодуючий ген Homo Sapiens

TERF2IP (англ. TERF2 interacting protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 399 амінокислот, а молекулярна маса — 44 260[4].

TERF2IP
PBB Protein TERF2IP image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TERF2IP, DRIP5, RAP1, TERF2 interacting protein
Зовнішні ІД OMIM: 605061 MGI: 1929871 HomoloGene: 10357 GeneCards: TERF2IP
Шаблон експресії
PBB GE TERF2IP 201174 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_018975
NM_020584
RefSeq (білок)
NP_061848
NP_065609
Локус (UCSC) Хр. 16: 75.65 – 75.76 Mb Хр. 8: 112.01 – 112.02 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGG
GTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYR
LGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKE
NARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDA
PVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAV
KKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEE
EEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFL
ASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Локалізований у цитоплазмі, ядрі, хромосомах.

ЛітератураРедагувати

  • Li B., Oestreich S., de Lange T. (2000). Identification of human RAP1: implications for telomere evolution.. Cell 101: 471 — 483.  PubMed DOI:10.1016/S0092-8674(00)80858-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tan M., Wei C., Price C.M. (2003). The telomeric protein Rap1 is conserved in vertebrates and is expressed from a bidirectional promoter positioned between the Rap1 and KARS genes.. Gene 323: 1 — 10.  PubMed DOI:10.1016/j.gene.2003.08.026
  • Liu D., O'Connor M.S., Qin J., Songyang Z. (2004). Telosome, a mammalian telomere-associated complex formed by multiple telomeric proteins.. J. Biol. Chem. 279: 51338 — 51342.  PubMed DOI:10.1074/jbc.M409293200
  • de Lange T. (2005). Shelterin: the protein complex that shapes and safeguards human telomeres.. Genes Dev. 19: 2100 — 2110.  PubMed DOI:10.1101/gad.1346005
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:19246 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9NYB0 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати