Відкрити головне меню

Синаптофізин

білок-кодуючий ген Homo Sapiens
(Перенаправлено з SYP)

SYP (англ. Synaptophysin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі X-хромосоми.[3] Довжина поліпептидного ланцюга білка становить 313 амінокислот, а молекулярна маса — 33 845[4].

SYP
Ідентифікатори
Символи SYP, MRX96, MRXsynaptophysin
Зовнішні ІД OMIM: 313475 MGI: 98467 HomoloGene: 2391 GeneCards: SYP
Шаблон експресії
PBB GE SYP 213200 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003179
NM_009305
RefSeq (білок)
NP_003170
NP_033331
Локус (UCSC) Хр. X: 49.19 – 49.2 Mb Хр. X: 7.64 – 7.65 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
LQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDY
SSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFA
FMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSG
LNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAY
GDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGY
GPQGAPTSFSNQM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію. Локалізований у мембрані, клітинних контактах, цитоплазматичних везикулах, синапсах, синаптосомах[en].

ЛітератураРедагувати

  • Suedhof T.C., Lottspeich F., Greengard P., Mehl E., Jahn R. (1987). The cDNA and derived amino acid sequences for rat and human synaptophysin.. Nucleic Acids Res. 15: 9607 — 9607.  PubMed DOI:10.1093/nar/15.22.9607
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11506 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P08247 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати