Відкрити головне меню

SPEN (англ. Spen family transcriptional repressor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 3 664 амінокислот, а молекулярна маса — 402 248[4].

SPEN
Protein SPEN PDB 1ow1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPEN, HIAA0929, MINT, RBM15C, SHARP, spen family transcriptional repressor
Зовнішні ІД OMIM: 613484 MGI: 1891706 HomoloGene: 124461 GeneCards: SPEN
Шаблон експресії
PBB GE SPEN 201997 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015001
NM_019763
NM_001347235
RefSeq (білок)
NP_055816
NP_001334164
NP_062737
Локус (UCSC) Хр. 1: 15.85 – 15.94 Mb Хр. 4: 141.47 – 141.54 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAF
VDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIPSAARGLDDTVSIASR
SREVSGFRGGGGGPAYGPPPSLHAREGRYERRLDGASDNRERAYEHSAYG
HHERGTGGFDRTRHYDQDYYRDPRERTLQHGLYYASRSRSPNRFDAHDPR
YEPRAREQFTLPSVVHRDIYRDDITREVRGRRPERNYQHSRSRSPHSSQS
RNQSPQRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSTSSDSSDSSSS
SSDDSPARSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLPVRSTDTS
LKDGLFHEFKKFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKL
FFGMQIEVTAWIGPETESENEFRPLDERIDEFHPKATRTLFIGNLEKTTT
YHDLRNIFQRFGEIVDIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEY
LGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDR
LKGMALVLYNEIEYAQAAVKETKGRKIGGNKIKVDFANRESQLAFYHCME
KSGQDIRDFYEMLAERREERRASYDYNQDRTYYESVRTPGTYPEDSRRDY
PARGREFYSEWETYQGDYYESRYYDDPREYRDYRNDPYEQDIREYSYRQR
ERERERERFESDRDRDHERRPIERSQSPVHLRRPQSPGASPSQAERLPSD
SERRLYSRSSDRSGSCSSLSPPRYEKLDKSRLERYTKNEKTDKERTFDPE
RVERERRLIRKEKVEKDKTDKQKRKGKVHSPSSQSSETDQENEREQSPEK
PRSCNKLSREKADKEGIAKNRLELMPCVVLTRVKEKEGKVIDHTPVEKLK
AKLDNDTVKSSALDQKLQVSQTEPAKSDLSKLESVRMKVPKEKGLSSHVE
VVEKEGRLKARKHLKPEQPADGVSAVDLEKLEARKRRFADSNLKAEKQKP
EVKKSSPEMEDARVLSKKQPDVSSREVILLREGEAERKPVRKEILKRESK
KIKLDRLNTVASPKDCQELASISVGSGSRPSSDLQARLGELAGESVENQE
VQSKKPIPSKPQLKQLQVLDDQGPEREDVRKNYCSLRDETPERKSGQEKS
HSVNTEEKIGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVD
EYERRSLVHEVGKPPQDVTDDSPPSKKKRMDHVDFDICTKRERNYRSSRQ
ISEDSERTGGSPSVRHGSFHEDEDPIGSPRLLSVKGSPKVDEKVLPYSNI
TVREESLKFNPYDSSRREQMADMAKIKLSVLNSEDELNRWDSQMKQDAGR
FDVSFPNSIIKRDSLRKRSVRDLEPGEVPSDSDEDGEHKSHSPRASALYE
SSRLSFLLRDREDKLRERDERLSSSLERNKFYSFALDKTITPDTKALLER
AKSLSSSREENWSFLDWDSRFANFRNNKDKEKVDSAPRPIPSWYMKKKKI
RTDSEGKMDDKKEDHKEEEQERQELFASRFLHSSIFEQDSKRLQHLERKE
EDSDFISGRIYGKQTSEGANSTTDSIQEPVVLFHSRFMELTRMQQKEKEK
DQKPKEVEKQEDTENHPKTPESAPENKDSELKTPPSVGPPSVTVVTLESA
PSALEKTTGDKTVEAPLVTEEKTVEPATVSEEAKPASEPAPAPVEQLEQV
DLPPGADPDKEAAMMPAGVEEGSSGDQPPYLDAKPPTPGASFSQAESNVD
PEPDSTQPLSKPAQKSEEANEPKAEKPDATADAEPDANQKAEAAPESQPP
ASEDLEVDPPVAAKDKKPNKSKRSKTPVQAAAVSIVEKPVTRKSERIDRE
KLKRSNSPRGEAQKLLELKMEAEKITRTASKNSAADLEHPEPSLPLSRTR
RRNVRSVYATMGDHENRSPVKEPVEQPRVTRKRLERELQEAAAVPTTPRR
GRPPKTRRRADEEEENEAKEPAETLKPPEGWRSPRSQKTAAGGGPQGKKG
KNEPKVDATRPEATTEVGPQIGVKESSMEPKAAEEEAGSEQKRDRKDAGT
DKNPPETAPVEVVEKKPAPEKNSKSKRGRSRNSRLAVDKSASLKNVDAAV
SPRGAAAQAGERESGVVAVSPEKSESPQKEDGLSSQLKSDPVDPDKEPEK
EDVSASGPSPEATQLAKQMELEQAVEHIAKLAEASASAAYKADAPEGLAP
EDRDKPAHQASETELAAAIGSIINDISGEPENFPAPPPYPGESQTDLQPP
AGAQALQPSEEGMETDEAVSGILETEAATESSRPPVNAPDPSAGPTDTKE
ARGNSSETSHSVPEAKGSKEVEVTLVRKDKGRQKTTRSRRKRNTNKKVVA
PVESHVPESNQAQGESPAANEGTTVQHPEAPQEEKQSEKPHSTPPQSCTS
DLSKIPSTENSSQEISVEERTPTKASVPPDLPPPPQPAPVDEEPQARFRV
HSIIESDPVTPPSDPSIPIPTLPSVTAAKLSPPVASGGIPHQSPPTKVTE
WITRQEEPRAQSTPSPALPPDTKASDVDTSSSTLRKILMDPKYVSATSVT
STSVTTAIAEPVSAAPCLHEAPPPPVDSKKPLEEKTAPPVTNNSEIQASE
VLVAADKEKVAPVIAPKITSVISRMPVSIDLENSQKITLAKPAPQTLTGL
VSALTGLVNVSLVPVNALKGPVKGSVTTLKSLVSTPAGPVNVLKGPVNVL
TGPVNVLTTPVNATVGTVNAAPGTVNAAASAVNATASAVTVTAGAVTAAS
GGVTATTGTVTMAGAVIAPSTKCKQRASANENSRFHPGSMPVIDDRPADA
GSGAGLRVNTSEGVVLLSYSGQKTEGPQRISAKISQIPPASAMDIEFQQS
VSKSQVKPDSVTASQPPSKGPQAPAGYANVATHSTLVLTAQTYNASPVIS
SVKADRPSLEKPEPIHLSVSTPVTQGGTVKVLTQGINTPPVLVHNQLVLT
PSIVTTNKKLADPVTLKIETKVLQPANLGSTLTPHHPPALPSKLPTEVNH
VPSGPSIPADRTVSHLAAAKLDAHSPRPSGPGPSSFPRASHPSSTASTAL
STNATVMLAAGIPVPQFISSIHPEQSVIMPPHSITQTVSLSHLSQGEVRM
NTPTLPSITYSIRPEALHSPRAPLQPQQIEVRAPQRASTPQPAPAGVPAL
ASQHPPEEEVHYHLPVARATAPVQSEVLVMQSEYRLHPYTVPRDVRIMVH
PHVTAVSEQPRAADGVVKVPPASKAPQQPGKEAAKTPDAKAAPTPTPAPV
PVPVPLPAPAPAPHGEARILTVTPSNQLQGLPLTPPVVVTHGVQIVHSSG
ELFQEYRYGDIRTYHPPAQLTHTQFPAASSVGLPSRTKTAAQGPPPEGEP
LQPPQPVQSTQPAQPAPPCPPSQLGQPGQPPSSKMPQVSQEAKGTQTGVE
QPRLPAGPANRPPEPHTQVQRAQAETGPTSFPSPVSVSMKPDLPVSLPTQ
TAPKQPLFVPTTSGPSTPPGLVLPHTEFQPAPKQDSSPHLTSQRPVDMVQ
LLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIA
QRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFI
TYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASI
SNISPHLMIVIASV

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК, РНК. Локалізований у ядрі.

ЛітератураРедагувати

  • Shi Y., Hon M., Evans R.M. (2002). The peroxisome proliferator-activated receptor delta, an integrator of transcriptional repression and nuclear receptor signaling.. Proc. Natl. Acad. Sci. U.S.A. 99: 2613 — 2618.  PubMed DOI:10.1073/pnas.052707099
  • Ariyoshi M., Schwabe J.W.R. (2003). A conserved structural motif reveals the essential transcriptional repression function of Spen proteins and their role in developmental signaling.. Genes Dev. 17: 1909 — 1920.  PubMed DOI:10.1101/gad.266203

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17575 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q96T58 (англ.). Процитовано 28 серпня 2017. 

Див. такожРедагувати