Відкрити головне меню

SLC4A1 (англ. Solute carrier family 4 member 1 (Diego blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 911 амінокислот, а молекулярна маса — 101 792[5].

SLC4A1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SLC4A1, solute carrier family 4 (anion exchanger), member 1 (Diego blood group), AE1, BND3, CD233, DI, EMPB3, EPB3, FR, RTA1A, SW, WD, WD1, WR, CHC, SAO, SPH4, solute carrier family 4 member 1 (Diego blood group)
Зовнішні ІД OMIM: 109270 MGI: 109393 HomoloGene: 133556 GeneCards: SLC4A1
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE SLC4A1 205592 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000342
NM_011403
RefSeq (білок)
NP_000333
NP_035533
Локус (UCSC) Хр. 17: 44.25 – 44.27 Mb Хр. 11: 102.35 – 102.37 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTS
HPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLS
HLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDR
EELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF
CEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEA
AELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYM
AQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS
PAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDA
FSPQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGIL
FALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILL
VVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQ
KTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGK
LRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARGWVI
HPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGS
GFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAA
AQIQEVKEQRISGLLVAVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSL
SGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVV
KSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEG
RDEYDEVAMPV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, ацетилювання, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Tanner M.J.A., Martin P.G., High S. (1988). The complete amino acid sequence of the human erythrocyte membrane anion-transport protein deduced from the cDNA sequence.. Biochem. J. 256: 703 — 712.  PubMed DOI:10.1042/bj2560703
  • Lux S.E., John K.M., Kopito R.R., Lodish H.F. (1989). Cloning and characterization of band 3, the human erythrocyte anion-exchange protein (AE1).. Proc. Natl. Acad. Sci. U.S.A. 86: 9089 — 9093.  PubMed DOI:10.1073/pnas.86.23.9089
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yannoukakos D., Vasseur C., Blouquit Y., Bursaux E., Wajcman H. (1989). Primary structure of the cytoplasmic domain of human erythrocyte protein band 3. Comparison with its sequence in the mouse.. Biochim. Biophys. Acta 998: 43 — 49.  PubMed DOI:10.1016/0167-4838(89)90116-7
  • Brock C.J., Tanner M.J.A., Kempf C. (1983). The human erythrocyte anion-transport protein. Partial amino acid sequence, conformation and a possible molecular mechanism for anion exchange.. Biochem. J. 213: 577 — 586.  PubMed DOI:10.1042/bj2130577
  • Yannoukakos D., Vasseur C., Piau J.-P., Wajcman H., Bursaux E. (1991). Phosphorylation sites in human erythrocyte band 3 protein.. Biochim. Biophys. Acta 1061: 253 — 266.  PubMed DOI:10.1016/0005-2736(91)90291-F

ПриміткиРедагувати

Див. такожРедагувати