Відкрити головне меню

SCARB1 (англ. Scavenger receptor class B member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 552 амінокислот, а молекулярна маса — 60 878[2].

SCARB1
Ідентифікатори
Символи SCARB1CD36 and LIMPII analogous 1Collagen type I receptorthrombospondin receptor-like 1scavenger receptor class B type IIICLA-1SR-BICD36 antigen (collagen type I receptorthrombospondin receptor)-like 1CD36 antigen-like 1scavenger receptor class B member 1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSS
LSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
SNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMEN
KPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFP
FKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQ
CNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGI
GQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLA
LGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAW
SPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLGGGT
GS

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу віруса, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kawasaki Y., Nakagawa A., Nagaosa K., Shiratsuchi A., Nakanishi Y. (2002). Phosphatidylserine binding of class B scavenger receptor type I, a phagocytosis receptor of testicular Sertoli cells.. J. Biol. Chem. 277: 27559 — 27566.  PubMed DOI:10.1074/jbc.M202879200
  • Philips J.A., Rubin E.J., Perrimon N. (2005). Drosophila RNAi screen reveals CD36 family member required for mycobacterial infection.. Science 309: 1251 — 1253.  PubMed DOI:10.1126/science.1116006
  • Calvo D., Vega M. (1993). Identification, primary structure and distribution of CLA-1, a novel member of the CD36/LIMPII gene family.. J. Biol. Chem. 268: 18929 — 18935.  PubMed
  • Webb N.R., de Villiers W.J., Connell P.M., de Beer F.C., van der Westhuyzen D.R. (1997). Alternative forms of the scavenger receptor BI (SR-BI).. J. Lipid Res. 38: 1490 — 1495.  PubMed

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:1664 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, Q8WTV0 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати