RYR2

білок-кодуючий ген Homo Sapiens

RYR2 (англ. Ryanodine receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 4 967 амінокислот, а молекулярна маса — 564 567[6].

RYR2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RYR2, ARVC2, ARVD2, RYR-2, RyR, VTSIP, ryanodine receptor 2, VACRDS
Зовнішні ІД OMIM: 180902 MGI: 99685 HomoloGene: 37423 GeneCards: RYR2
Пов'язані генетичні захворювання
ожиріння, lymphoblastic leukemia, arrhythmogenic right ventricular dysplasia 2[1]
Реагує на сполуку
Аденозинтрифосфат, кофеїн, сурамін, Прокаїн[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001035
NM_023868
RefSeq (білок)
NP_001026
NP_076357
Локус (UCSC) Хр. 1: 237.04 – 237.83 Mb Хр. 13: 11.55 – 12.11 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLE
STSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKF
MMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQ
EDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGS
LHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSG
EHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMG
TSEIKYGDSVCYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMD
DGISLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKAKASTVDLPIE
SVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLE
CIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQ
FSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVN
HVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWAST
EGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLR
TDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKV
RFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDL
LGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHV
GISDEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLA
ENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSL
REAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVKAGR
WYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNE
HYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMW
LSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIM
FYRLSMPIECAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTA
HGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTS
HSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPANVWVGWITSDF
HQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSP
NVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMP
NQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEEL
LKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRA
GYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDENKKHGLPG
IGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKSKTIQMLTEAVK
EGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSV
FKEAATPEEESDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPE
PVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQA
LNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFH
EDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKPVES
DSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVR
ALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIM
NNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFL
CYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDN
NELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLD
FLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEA
IKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYSALIDLLG
RCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGN
VVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAA
SLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLH
TVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLN
EHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFD
ALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN
FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDS
SKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMAL
YNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHN
IWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQING
YAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRGK
GEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKE
KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGL
ESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVA
LLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVER
QRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALSLPTN
VEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWW
EHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLA
VFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSE
AELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVA
EVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERK
KMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSLKD
TEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDDTSDPEKTVER
VLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVV
ACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAE
PPEEDEGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCH
DEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGE
TGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSC
SVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGH
NSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDE
QGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHV
FAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMV
DMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHK
AMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAV
LLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYF
EISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEM
QLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRY
NILTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVAS
VFRGFFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGE
RKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNA
GLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPEKAEGEDGEKE
EKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFY
NMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSS
SHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIF
KREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVK
RKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNS
IDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGF
KTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGD
TPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITF
FFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDT
VPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWE
FFPAGDCFRKQYEDQLN

Кодований геном білок за функціями належить до рецепторів, іонних каналів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт кальцію, поліморфізм. Білок має сайт для зв'язування з молекулою кальмодуліну, іоном кальцію. Локалізований у мембрані, саркоплазматичному ретикулумі.

ЛітератураРедагувати

  • Awad S.S., Lamb H.K., Morgan J.M., Dunlop W., Gillespie J.I. (1997). Differential expression of ryanodine receptor RyR2 mRNA in the non-pregnant and pregnant human myometrium.. Biochem. J. 322: 777 — 783.  PubMed DOI:10.1042/bj3220777
  • Martin C., Chapman K.E., Seckl J.R., Ashley R.H. (1998). Partial cloning and differential expression of ryanodine receptor/calcium-release channel genes in human tissues including the hippocampus and cerebellum.. Neuroscience 85: 205 — 216.  PubMed DOI:10.1016/S0306-4522(97)00612-X
  • Bers D.M. (2002). Cardiac excitation-contraction coupling.. Nature 415: 198 — 205.  PubMed DOI:10.1038/415198a
  • Currie S. (2009). Cardiac ryanodine receptor phosphorylation by CaM Kinase II: keeping the balance right.. Front. Biosci. 14: 5134 — 5156.  PubMed DOI:10.2741/3591
  • Ozawa T. (2010). Modulation of ryanodine receptor Ca2+ channels.. Mol. Med. Report. 3: 199 — 204.  PubMed DOI:10.3892/mmr_00000240
  • Lanner J.T., Georgiou D.K., Joshi A.D., Hamilton S.L. (2010). Ryanodine receptors: structure, expression, molecular details, and function in calcium release.. Cold Spring Harb. Perspect. Biol. 2: E3996 — E3996.  PubMed DOI:10.1101/cshperspect.a003996

ПриміткиРедагувати

Див. такожРедагувати