Відкрити головне меню

RHD (англ. Rh blood group D antigen) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 417 амінокислот, а молекулярна маса — 45 211[4].

RHD
Ідентифікатори
Символи RHD, CD240D, DIIIc, RH, RH30, RHCED, RHDVA(TT), RHDel, RHPII, RHXIII, Rh4, RhDCw, RhII, RhK562-II, RhPI, Rh blood group D antigen
Зовнішні ІД MGI: 1202882 HomoloGene: 7918 GeneCards: RHD
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011270
RefSeq (білок)
NP_035400
Локус (UCSC) Хр. 1: 25.27 – 25.33 Mb Хр. 4: 134.86 – 134.9 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV
GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ
FPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTAL
GNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQ
TATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVV
TAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLV
AGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLD
TVGAGNGMIGFQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAK
YFDDQVFWKFPHLAVGF

Задіяний у такому біологічному процесі як поліморфізм. Локалізований у мембрані.

ЛітератураРедагувати

  • Kajii E., Umenishi F., Iwamoto S., Ikemoto S. (1993). Isolation of a new cDNA clone encoding an Rh polypeptide associated with the Rh blood group system.. Hum. Genet. 91: 157 — 162.  PubMed DOI:10.1007/BF00222717
  • Shao C.P., Xiong W., Zhou Y.Y. (2006). Multiple isoforms excluding normal RhD mRNA detected in Rh blood group Del phenotype with RHD 1227A allele.. Transfus. Apher. Sci. 34: 145 — 152.  PubMed DOI:10.1016/j.transci.2005.10.001
  • Saboori A.M., Smith B.L., Agre P. (1988). Polymorphism in the Mr 32,000 Rh protein purified from Rh(D)-positive and -negative erythrocytes.. Proc. Natl. Acad. Sci. U.S.A. 85: 4042 — 4045.  PubMed DOI:10.1073/pnas.85.11.4042
  • Rouillac C., le van Kim C., Beolet M., Cartron J.-P., Colin Y. (1995). Leu110Pro substitution in the RhD polypeptide is responsible for the DVII category blood group phenotype.. Am. J. Hematol. 49: 87 — 88.  PubMed DOI:10.1002/ajh.2830490115
  • Westhoff C.M., Wylie D.E. (1994). Identification of a new RhD-specific mRNA from K562 cells.. Blood 83: 3098 — 3100.  PubMed
  • Huang C.-H., Reid M.E., Chen Y. (1995). Identification of a partial internal deletion in the RH locus causing the human erythrocyte D-phenotype.. Blood 86: 784 — 790.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:10009 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q02161 (англ.). Процитовано 25 серпня 2017. 

Див. такожРедагувати