PYGB (англ. Glycogen phosphorylase B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 843 амінокислот, а молекулярна маса — 96 696[4].

PYGB
Ідентифікатори
Символи PYGB, GPBB, phosphorylase, glycogen; brain, glycogen phosphorylase B
Зовнішні ІД OMIM: 138550 MGI: 97828 HomoloGene: 100930 GeneCards: PYGB
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002862
NM_153781
RefSeq (білок)
NP_002853
NP_722476
Локус (UCSC) Хр. 20: 25.25 – 25.3 Mb Хр. 2: 150.79 – 150.83 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPR
DYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM
VNLGLQNACDEAIYQLGLDLEELEEIEEDAGLGNGGLGRLAACFLDSMAT
LGLAAYGYGIRYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLP
VHFYGRVEHTPDGVKWLDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAP
NDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPEL
MRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRH
LEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGS
HAVNGVARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGL
ADTIVEKIGEEFLTDLSQLKKLLPLVSDEVFIRDVAKVKQENKLKFSAFL
EKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFV
PRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYR
VSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM
AEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGF
FSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTK
KVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNIPRD

Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Задіяний у таких біологічних процесах як вуглеводний обмін, метаболізм глікогену. Білок має сайт для зв'язування з піридоксаль-фосфатом.

ЛітератураРедагувати

  • Gelinas R.P., Froman B.E., McElroy F., Tait R.C., Gorin F.A. (1989). Human brain glycogen phosphorylase: characterization of fetal cDNA and genomic sequences.. Brain Res. Mol. Brain Res. 6: 177 — 185.  PubMed DOI:10.1016/0169-328X(89)90052-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Newgard C.B., Littman D.R., van Genderen C., Smith M., Fletterick R.J. (1988). Human brain glycogen phosphorylase. Cloning, sequence analysis, chromosomal mapping, tissue expression, and comparison with the human liver and muscle isozymes.. J. Biol. Chem. 263: 3850 — 3857.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9723 (англ.). Процитовано 6 лютого 2017. 
  4. UniProt, P11216 (англ.). Процитовано 6 лютого 2017. 

Див. такожРедагувати