Відкрити головне меню

PRPSAP1 (англ. Phosphoribosyl pyrophosphate synthetase associated protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 356 амінокислот, а молекулярна маса — 39 394[4].

PRPSAP1
Protein PRPSAP1 PDB 2c4k.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PRPSAP1, PAP39, phosphoribosyl pyrophosphate synthetase-associated protein 1, phosphoribosyl pyrophosphate synthetase associated protein 1
Зовнішні ІД MGI: 1915013 HomoloGene: 55687 GeneCards: PRPSAP1
Шаблон експресії
PBB GE PRPSAP1 202529 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002766
NM_001330503
NM_001366236
NM_026364
RefSeq (білок)
NP_001317432
NP_002757
NP_001353165
NP_080640
Локус (UCSC) Хр. 17: 76.31 – 76.38 Mb Хр. 11: 116.47 – 116.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MNAARTGYRVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVE
IKESVRGQDIFIIQTIPRDVNTAVMELLIMAYALKTACARNIIGVIPYFP
YSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQGFFSFPVDN
LRASPFLLQYIQEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLAVIHG
EAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGR
IAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGILSAEAPRLIEES
SVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFR
NITVDD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9466 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q14558 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати