PMP22

білок-кодуючий ген Homo Sapiens

PMP22 (англ. Peripheral myelin protein 22) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 160 амінокислот, а молекулярна маса — 17 891[5].

PMP22
Ідентифікатори
Символи PMP22, CMT1A, CMT1E, DSS, GAS-3, HMSNIA, HNPP, Sujojp110, GAS3, peripheral myelin protein 22, CIDP, Sp110
Зовнішні ІД OMIM: 601097 MGI: 97631 HomoloGene: 7482 GeneCards: PMP22
Пов'язані генетичні захворювання
hereditary neuropathy with liability to pressure palsies, Charcot-Marie-Tooth disease type 1E, chronic inflammatory demyelinating polyradiculoneuropathy[1]
Шаблон експресії
PBB GE PMP22 210139 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 17: 15.23 – 15.27 Mb Хр. 11: 63.02 – 63.05 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNV
HHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITG
IFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAWVAFPLALLSG
VIYVILRKRE

Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

ПриміткиРедагувати

Див. такожРедагувати