Відкрити головне меню

PLK4 (англ. Polo like kinase 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 970 амінокислот, а молекулярна маса — 108 972[5].

PLK4
Protein PLK4 PDB 1mby.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PLK4, SAK, STK18, MCCRP2, polo like kinase 4
Зовнішні ІД MGI: 101783 HomoloGene: 7962 GeneCards: PLK4
Реагує на сполуку
axitinib[1]
Шаблон експресії
PBB GE PLK4 204886 at fs.png

PBB GE PLK4 211088 s at fs.png

PBB GE PLK4 204887 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001190799
NM_001190801
NM_014264
NM_011495
NM_173169
RefSeq (білок)
NP_001177728
NP_001177730
NP_055079
NP_035625
NP_775261
Локус (UCSC) Хр. 4: 127.88 – 127.9 Mb Хр. 3: 40.8 – 40.82 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYK
AGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRY
LKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNI
KIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCM
FYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNP
ADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQ
ETSNSGRGRVIQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCH
SAEMLSVSKRSGGGENEERYSPTDNNANIFNFFKEKTSSSSGSFERPDNN
QALSNHLCPGKTPFPFADPTPQTETVQQWFGNLQINAHLRKTTEYDSISP
NRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQNTMKYMTALH
SKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYY
PNGGRGFPLADRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKS
PKITYFTRYAKCILMENSPGADFEVWFYDGVKIHKTEDFIQVIEKTGKSY
TLKSESEVNSLKEEIKMYMDHANEGHRICLALESIISEEERKTRSAPFFP
IIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMHSAASPTQAPI
LNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQ
KLQCLSSILLMFSNPTPNFH

Кодований геном білок за функціями належить до трансфераз, кіназ, cерин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, ядрі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Habedanck R., Stierhof Y.-D., Wilkinson C.J., Nigg E.A. (2005). The Polo kinase Plk4 functions in centriole duplication.. Nat. Cell Biol. 7: 1140 — 1146.  PubMed DOI:10.1038/ncb1320
  • Bonni S., Ganuelas M.L., Petrinac S., Hudson J.W. (2008). Human Plk4 phosphorylates Cdc25C.. Cell Cycle 7: 545 — 547.  PubMed DOI:10.4161/cc.7.4.5387
  • Petrinac S., Ganuelas M.L., Bonni S., Nantais J., Hudson J.W. (2009). Polo-like kinase 4 phosphorylates Chk2.. Cell Cycle 8: 327 — 329.  PubMed DOI:10.4161/cc.8.2.7355
  • Kuriyama R., Bettencourt-Dias M., Hoffmann I., Arnold M., Sandvig L. (2009). Gamma-tubulin-containing abnormal centrioles are induced by insufficient Plk4 in human HCT116 colorectal cancer cells.. J. Cell Sci. 122: 2014 — 2023.  PubMed DOI:10.1242/jcs.036715

ПриміткиРедагувати

Див. такожРедагувати