Відкрити головне меню

PKD2 (англ. Polycystin 2, transient receptor potential cation channel) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 968 амінокислот, а молекулярна маса — 109 691[4].

PKD2
5mke.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PKD2, APC2, PKD4, Pc-2, TRPP2, Polycystic kidney disease 2, polycystin 2, transient receptor potential cation channel
Зовнішні ІД MGI: 1099818 HomoloGene: 20104 GeneCards: PKD2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000297
NM_008861
RefSeq (білок)
NP_000288
NP_032887
Локус (UCSC) Хр. 4: 88.01 – 88.08 Mb Хр. 5: 104.46 – 104.51 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQR
GLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEE
EEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHP
SGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGL
WGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYT
RMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQ
TEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSV
SSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTRE
ETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGG
VIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKL
HYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEH
LAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGF
AIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIE
EANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMEL
SDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGH
TDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPM
SSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRME
HSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEI
HREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQ
STEGMEGAGGNGSSNVHV

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт калію, транспорт кальцію, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію, калію. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі, клітинних відростках, війках, цитоплазматичних везикулах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gallagher A.R., Cedzich A., Gretz N., Somlo S., Witzgall R. (2000). The polycystic kidney disease protein PKD2 interacts with Hax-1, a protein associated with the actin cytoskeleton.. Proc. Natl. Acad. Sci. U.S.A. 97: 4017 — 4022.  PubMed DOI:10.1073/pnas.97.8.4017
  • Stayner C., Zhou J. (2001). Polycystin channels and kidney disease.. Trends Pharmacol. Sci. 22: 543 — 546.  PubMed DOI:10.1016/S0165-6147(00)01832-0
  • Streets A.J., Moon D.J., Kane M.E., Obara T., Ong A.C. (2006). Identification of an N-terminal glycogen synthase kinase 3 phosphorylation site which regulates the functional localization of polycystin-2 in vivo and in vitro.. Hum. Mol. Genet. 15: 1465 — 1473.  PubMed DOI:10.1093/hmg/ddl070
  • Streets A.J., Needham A.J., Gill S.K., Ong A.C. (2010). Protein kinase D-mediated phosphorylation of polycystin-2 (TRPP2) is essential for its effects on cell growth and calcium channel activity.. Mol. Biol. Cell 21: 3853 — 3865.  PubMed DOI:10.1091/mbc.E10-04-0377
  • del Rocio Cantero M., Velazquez I.F., Streets A.J., Ong A.C.M., Cantiello H.F. (2015). The cAMP Signaling Pathway and Direct Protein Kinase A Phosphorylation Regulate Polycystin-2 (TRPP2) Channel Function.. J. Biol. Chem. 290: 23888 — 23896.  PubMed DOI:10.1074/jbc.M115.661082

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9009 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q13563 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати