PDP1

білок-кодуючий ген Homo Sapiens

PDP1 (англ. Pyruvate dehyrogenase phosphatase catalytic subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 537 амінокислот, а молекулярна маса — 61 054[4].

PDP1
Ідентифікатори
Символи PDP1, PDH, PDP, PDPC, PPM2C, PPM2A, pyruvate dehyrogenase phosphatase catalytic subunit 1, pyruvate dehydrogenase phosphatase catalytic subunit 1
Зовнішні ІД OMIM: 605993 MGI: 2685870 HomoloGene: 31928 GeneCards: PDP1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001161778
NM_001161779
NM_001161780
NM_001161781
NM_018444
NM_001033453
NM_001098230
NM_001098231
NM_001290387
NM_001290391
RefSeq (білок)
NP_001155251
NP_001155252
NP_001155253
NP_060914
NP_001028625
NP_001091700
NP_001091701
NP_001277316
NP_001277320
Локус (UCSC) Хр. 8: 93.86 – 93.93 Mb Хр. 4: 11.96 – 11.97 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHP
AYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPE
FDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCA
CSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYF
SKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLE
AQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQE
EDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPF
RAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPE
VTYHRLRPQDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQPIAVGG
YKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNNEFGTVDHERL
SKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQE

Кодований геном білок за функціями належить до гідролаз, протеїн-фосфатаз. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію, іоном магнію. Локалізований у мітохондрії.

Література ред.

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки ред.

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:9279 (англ.) . Процитовано 7 вересня 2017.
  4. UniProt, Q9P0J1 (англ.) . Архів оригіналу за 29 серпня 2017. Процитовано 7 вересня 2017.

Див. також ред.