Відкрити головне меню

NTS (англ. Neurotensin) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 170 амінокислот, а молекулярна маса — 19 795[4].

NTS
Neurotensin.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NTS, NMN-125, NN, NT, NT/N, NTS1, neurotensin
Зовнішні ІД OMIM: 162650 MGI: 1328351 HomoloGene: 4506 GeneCards: NTS
Шаблон експресії
PBB GE NTS 206291 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006183
NM_024435
RefSeq (білок)
NP_006174
NP_006174.1
NP_077755
Локус (UCSC) Хр. 12: 85.87 – 85.88 Mb Хр. 10: 102.48 – 102.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAH
VPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEA
MLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKR
QLYENKPRRPYILKRDSYYY

Кодований геном білок за функцією належить до вазоактивних білків. Локалізований у цитоплазматичних везикулах. Також секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bean A.J., Dagerlind A., Hoekfelt T., Dobner P.R. (1992). Cloning of human neurotensin/neuromedin N genomic sequences and expression in the ventral mesencephalon of schizophrenics and age/sex matched controls.. Neuroscience 50: 259 — 268.  PubMed DOI:10.1016/0306-4522(92)90421-W
  • Da Costa G., Bondon A., Coutant J., Curmi P., Monti J.P. (2013). Intermolecular interactions between the neurotensin and the third extracellular loop of human neurotensin 1 receptor.. J. Biomol. Struct. Dyn. 31: 1381 — 1392.  PubMed DOI:10.1080/07391102.2012.736776
  • Dong Z., Wang X., Zhao Q., Townsend C.M. Jr., Evers B.M. (1998). DNA methylation contributes to expression of the human neurotensin/neuromedin N gene.. Am. J. Physiol. 274: G535 — G543.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8038 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P30990 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати