NOTCH2

білок-кодуючий ген Homo Sapiens

NOTCH2 (англ. Notch 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 471 амінокислот, а молекулярна маса — 265 405[4].

NOTCH2
Protein NOTCH2 PDB 2oo4.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NOTCH2, AGS2, HJCYS, hN2, Notch-2, notch 2, notch receptor 2
Зовнішні ІД OMIM: 600275 MGI: 97364 HomoloGene: 7865 GeneCards: NOTCH2
Шаблон експресії
PBB GE NOTCH2 202445 s at fs.png

PBB GE NOTCH2 212377 s at fs.png

PBB GE NOTCH2 202443 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001200001
NM_024408
NM_010928
RefSeq (білок)
NP_001186930
NP_077719
NP_035058
Локус (UCSC) Хр. 1: 119.91 – 120.1 Mb Хр. 3: 97.92 – 98.06 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGY
CKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGED
CQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLS
HPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLN
LPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLP
GFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPG
STCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYI
CTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAG
PRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQS
NPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDH
PNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCA
SNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCING
VNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWV
GINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECA
SNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKE
SPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDM
NECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGG
TCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCS
CPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDV
PNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQL
DECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSC
RCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRH
CETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVK
CRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSC
QCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQW
DGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIV
VLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAM
KKQRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALL
ASHAIQGTLSYPLVSVVSESLTPERTQLLYLLAVAVVIILFIILLGVIMA
KRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLI
GTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDED
AEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAG
ADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLIL
AARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNG
ANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVA
RDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSP
VDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALS
FSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGSLSRLHPVPVP
ADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREP
LPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPS
VAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGG
GQRGPGTHMSEPPHNNMQVYA

Кодований геном білок за функціями належить до рецепторів, активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

ЛітератураРедагувати

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7882 (англ.). Архів оригіналу за 15 червня 2017. Процитовано 25 серпня 2017. 
  4. UniProt, Q04721 (англ.). Архів оригіналу за 3 жовтня 2017. Процитовано 25 серпня 2017. 

Див. такожРедагувати