Відкрити головне меню

NOS2 (англ. Nitric oxide synthase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 1 153 амінокислот, а молекулярна маса — 131 117[6].

NOS2
PDB 1nsi EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NOS2, HEP-NOS, INOS, NOS, NOS2A, Nitric oxide synthase 2
Зовнішні ІД OMIM: 163730 MGI: 97361 HomoloGene: 55473 GeneCards: NOS2
Пов'язані генетичні захворювання
Псоріаз[1]
Реагує на сполуку
pimagedine, nitroarginine, 2-amino-4-methylpyridine[2]
Шаблон експресії
PBB GE NOS2A 210037 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000625
NM_153292
NM_010927
NM_001313921
NM_001313922
RefSeq (білок)
NP_000616
NP_001300850
NP_001300851
NP_035057
Локус (UCSC) Хр. 17: 27.76 – 27.8 Mb Хр. 11: 78.92 – 78.96 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLS
KQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTL
HHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQY
YGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC
IGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQR
SDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALP
AVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMG
LETHKLASLWKDQAVVEINIAVLHSFQKQNVTIMDHHSAAESFMKYMQNE
YRSRGGCPADWIWLVPPMSGSITPVFHQEMLNYVLSPFYYYQVEAWKTHV
WQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKS
EALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGA
SQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTS
NVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSR
ATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDGPTPHQT
VRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQLLLQKLAQVA
TEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNS
LKPQDPVPCFVRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDS
QHKGVRGGRMTLVFGCRRPDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPG
KPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVA
AKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQPSSLEM
SAL

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою кальмодуліну, іонами металів, іоном цинку, іоном кальцію, іоном заліза, гемом, НАДФ, ФАД, флавопротеїном.

ЛітератураРедагувати

  • Sherman P.A., Laubach V.E., Reep B.R., Wood E.R. (1993). Purification and cDNA sequence of an inducible nitric oxide synthase from a human tumor cell line.. Biochemistry 32: 11600 — 11605.  PubMed DOI:10.1021/bi00094a017
  • Maier R., Bilbe G., Rediske J., Lotz M. (1994). Inducible nitric oxide synthase from human articular chondrocytes: cDNA cloning and analysis of mRNA expression.. Biochim. Biophys. Acta 1208: 145 — 150.  PubMed DOI:10.1016/0167-4838(94)90171-6
  • Park C.S., Pardhasaradhi K., Gianotti C., Villegas E., Krishna G. (1994). Human retina expresses both constitutive and inducible isoforms of nitric oxide synthase mRNA.. Biochem. Biophys. Res. Commun. 205: 85 — 91.  PubMed DOI:10.1006/bbrc.1994.2633
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Glynne P.A., Darling K.E.A., Picot J., Evans T.J. (2002). Epithelial inducible nitric-oxide synthase is an apical EBP50-binding protein that directs vectorial nitric oxide output.. J. Biol. Chem. 277: 33132 — 33138.  PubMed DOI:10.1074/jbc.M205764200
  • Hokari A., Zeniya M., Esumi H. (1994). Cloning and functional expression of human inducible nitric oxide synthase (NOS) cDNA from a glioblastoma cell line A-172.. J. Biochem. 116: 575 — 581.  PubMed

ПриміткиРедагувати

Див. такожРедагувати