NIN

білок-кодуючий ген Homo Sapiens

NIN (англ. Ninein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 2 090 амінокислот, а молекулярна маса — 243 249[6].

NIN
Ідентифікатори
Символи NIN, SCKL7, ninein
Зовнішні ІД OMIM: 608684 MGI: 105108 HomoloGene: 40632 GeneCards: NIN
Пов'язані генетичні захворювання
Seckel syndrome 7[1]
Реагує на сполуку
Viroporin 3a [SARS-CoV-2][2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016350
NM_020921
NM_182944
NM_182945
NM_182946
NM_001081453
NM_001286079
NM_001286080
NM_008697
RefSeq (білок)
NP_057434
NP_065972
NP_891989
NP_891991
NP_001074922
NP_001273008
NP_001273009
NP_032723
Локус (UCSC) Хр. 14: 50.72 – 50.83 Mb Хр. 12: 70.01 – 70.11 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQ
QTLLQDNLLGRVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVR
GGKRYGRRSLPEFQESVEEFPEVTVIEPLDEEARPSHIPAGDCSEHWKTQ
RSEEYEAEGQLRFWNPDDLNASQSGSSPPQDWIEEKLQEVCEDLGITRDG
HLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVEDFFYGLFKNG
KSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMTSTIGFRVFSCLDD
GMGHASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENEL
LVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLM
ASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRKEREQILQQAGK
QRLELEQEIEKAKTEENYIRDRLALSLKENSRLENELLENAEKLAEYENL
TNKLQRNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEYERQCRVLQDQ
VDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNP
LNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKA
QENMKQRHENETHTLEKQISDLKNEIAELQGQAAVLKEAHHEATCRHEEE
KKQLQVKLEEEKTHLQEKLRLQHEMELKARLTQAQASFEREREGLQSSAW
TEEKVRGLTQELEQFHQEQLTSLVEKHTLEKEELRKELLEKHQRELQEGR
EKMETECNRRTSQIEAQFQSDCQKVTERCESALQSLEGRYRQELKDLQEQ
QREEKSQWEFEKDELTQECAEAQELLKETLKREKTTSLVLTQEREMLEKT
YKEHLNSMVVERQQLLQDLEDLRNVSETQQSLLSDQILELKSSHKRELRE
REEVLCQAGASEQLASQRLERLEMEHDQERQEMMSKLLAMENIHKATCET
ADRERAEMSTEISRLQSKIKEMQQATSPLSMLQSGCQVIGEEEVEGDGAL
SLLQQGEQLLEENGDVLLSLQRAHEQAVKENVKMATEISRLQQRLQKLEP
GLVMSSCLDEPATEFFGNTAEQTEQFLQQNRTKQVEGVTRRHVLSDLEDD
EVRDLGSTGTSSVQRQEVKIEESEASVEGFSELENSEETRTESWELKNQI
SQLQEQLMMLCADCDRASEKKQDLLFDVSVLKKKLKMLERIPEASPKYKL
LYEDVSRENDCLQEELRMMETRYDEALENNKELTAEVFRLQDELKKMEEV
TETFLSLEKSYDEVKIENEGLNVLVLRLQGKIEKLQESVVQRCDCCLWEA
SLENLEIEPDGNILQLNQTLEECVPRVRSVHHVIEECKQENQYLEGNTQL
LEKVKAHEIAWLHGTIQTHQERPRVQNQVILEENTTLLGFQDKHFQHQAT
IAELELEKTKLQELTRKLKERVTILVKQKDVLSHGEKEEELKAMMHDLQI
TCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLGTLNGS
QEEMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLENTELSQKN
SQNQEKLQELNQRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQ
SSTLVSSLEAELSEVKIQTHIVQQENHLLKDELEKMKQLHRCPDLSDFQQ
KISSVLSYNEKLLKEKEALSEELNSCVDKLAKSSLLEHRIATMKQEQKSW
EHQSASLKSQLVASQEKVQNLEDTVQNVNLQMSRMKSDLRVTQQEKEALK
QEVMSLHKQLQNAGGKSWAPEIATHPSGLHNQQKRLSWDKLDHLMNEEQQ
LLWQENERLQTMVQNTKAELTHSREKVRQLESNLLPKHQKHLNPSGTMNP
TEQEKLSLKRECDQFQKEQSPANRKVSQMNSLEQELETIHLENEGLKKKQ
VKLDEQLMEMQHLRSTATPSPSPHAWDLQLLQQQACPMVPREQFLQLQRQ
LLQAERINQHLQEELENRTSETNTPQGNQEQLVTVMEERMIEVEQKLKLV
KRLLQEKVNQLKEQVSLPGHLCSPTSHSSFNSSFTSLYCH

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

ЛітератураРедагувати

  • Hong Y.-R., Chen C.-H., Chuo M.-H., Liou S.-Y., Howng S.-L. (2000). Genomic organization and molecular characterization of the human ninein gene.. Biochem. Biophys. Res. Commun. 279: 989 — 995.  PubMed DOI:10.1006/bbrc.2000.4050
  • Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 273 — 281.  PubMed DOI:10.1093/dnares/7.4.271
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dammermann A., Merdes A. (2002). Assembly of centrosomal proteins and microtubule organization depends on PCM-1.. J. Cell Biol. 159: 255 — 266.  PubMed DOI:10.1083/jcb.200204023
  • Fritzler M.J., Zhang M., Stinton L.M., Rattner J.B. (2003). Spectrum of centrosome autoantibodies in childhood varicella and post-varicella acute cerebellar ataxia.. BMC Pediatr. 3: 11 — 11.  PubMed DOI:10.1186/1471-2431-3-11
  • Kodani A., Salome Sirerol-Piquer M., Seol A., Garcia-Verdugo J.M., Reiter J.F. (2013). Kif3a interacts with Dynactin subunit p150 Glued to organize centriole subdistal appendages.. EMBO J. 32: 597 — 607.  PubMed DOI:10.1038/emboj.2013.3

ПриміткиРедагувати

Див. такожРедагувати