Відкрити головне меню

NGF (англ. Nerve growth factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 241 амінокислот, а молекулярна маса — 26 959[4].

NGF
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NGF, Beta-HSAN5, NGFB, nerve growth factor
Зовнішні ІД OMIM: 162030 MGI: 97321 HomoloGene: 1876 GeneCards: NGF
Шаблон експресії
PBB GE NGFB 206814 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002506
NM_001112698
NM_013609
RefSeq (білок)
NP_002497
NP_001106168
NP_038637
Локус (UCSC) Хр. 1: 115.29 – 115.34 Mb Хр. 3: 102.47 – 102.52 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRR
ARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADT
QDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTAT
DIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSY
CTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Кодований геном білок за функціями належить до інгібіторів протеаз, факторів росту, інгібіторів металоферментів. Секретований назовні.

ЛітератураРедагувати

  • Ullrich A., Gray A., Berman C., Dull T.J. (1983). Human beta-nerve growth factor gene sequence highly homologous to that of mouse.. Nature 303: 821 — 825.  PubMed DOI:10.1038/303821a0
  • Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes.. Mol. Biol. Evol. 21: 936 — 944.  PubMed DOI:10.1093/molbev/msh100
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hallboeoek F., Ibanez C.F., Persson H. (1991). Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary.. Neuron 6: 845 — 858.  PubMed DOI:10.1016/0896-6273(91)90180-8
  • Klein R., Jing S., Nanduri V., O'Rourke E., Barbacid M. (1991). The trk proto-oncogene encodes a receptor for nerve growth factor.. Cell 65: 189 — 197.  PubMed DOI:10.1016/0092-8674(91)90419-Y
  • Wijeyewickrema L.C., Gardiner E.E., Gladigau E.L., Berndt M.C., Andrews R.K. (2010). Nerve growth factor inhibits metalloproteinase-disintegrins and blocks ectodomain shedding of platelet glycoprotein VI.. J. Biol. Chem. 285: 11793 — 11799.  PubMed DOI:10.1074/jbc.M110.100479

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7808 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P01138 (англ.). Процитовано 25 серпня 2017. 

Див. такожРедагувати