Відкрити головне меню

MYO9B

білок-кодуючий ген Homo Sapiens

MYO9B (англ. Myosin IXB) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 157 амінокислот, а молекулярна маса — 243 401[4].

MYO9B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYO9B, CELIAC4, MYR5, myosin IXB
Зовнішні ІД OMIM: 602129 MGI: 106624 HomoloGene: 3058 GeneCards: MYO9B
Шаблон експресії
PBB GE MYO9B 217297 s at fs.png

PBB GE MYO9B 214780 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001130065
NM_004145
NM_001142322
NM_001142323
NM_015742
RefSeq (білок)
NP_001123537
NP_004136
н/д
Локус (UCSC) Хр. 19: 17.08 – 17.21 Mb Хр. 8: 71.27 – 71.36 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKD
AIASLRLDGTKCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHP
QEDGYYFLLQERNADGTIKYVHMQLVAQATATRRLVERGLLPRQQADFDD
LCNLPELTEGNLLKNLKHRFLQQKIYTYAGSILVAINPFKFLPIYNPKYV
KMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGESGSGKTQSTN
FLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEER
QEFQLKQPEDYFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQ
IFAVLSAILYLGNVTYKKRATGREEGLEVGPPEVLDTLSQLLKVKREILV
EVLTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHA
LLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYANEQLQYYFNQ
HIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREK
NMDYMRPDIVALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLRE
AGRLRAERAEKAAGMSSPGAQSHPEELPRGASTPSEKLYRDLHNQMIKSI
KGLPWQGEDPRSLLQSLSRLQKPRAFILKSKGIKQKQIIPKNLLDSKSLK
LIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFI
RCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQE
TLHREVVRKILLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALE
RTQAAVYLQASWRGYWQRKLYRHQKQSIIRLQSLCRGHLQRKSFSQMISE
KQKAEEKEREALEAARAGAEEGGQGQAAGGQQVAEQGPEPAEDGGHLASE
PEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEKVPSSREKRES
RRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLER
PTSLALDSRVSPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRY
LDAERLASAVELWRGKKLVAAASPSAMLSQSLDLSDRHRATGAALTPTEE
RRTSFSTSDVSKLLPSLAKAQPAAETTDGERSAKKPAVQKKKPGDASSLP
DAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENAVSGHVVLEAT
TMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTM
YSVPNGKIHVGYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFT
RGYTKNDFEPVKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCL
SYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGV
CVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQAL
QTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIF
APCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEA
AESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLL
EEEAAGGDEDREKEILIERIQSIKEEKEDITYRLPELDPRGSDEENLDSE
TSASTESLLEERAGRGASEGPPAPALPCPGAPTPSPLPTVAAPPRRRPSS
FVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPP
ASGQTNG

Кодований геном білок за функціями належить до білкових моторів, міозинів, активаторів гтфаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну, іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті.

ЛітератураРедагувати

  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r
  • Wirth J.A., Jensen K.A., Post P.L., Bement W.M., Mooseker M.S. (1996). Human myosin-IXb, an unconventional myosin with a chimerin-like rho/rac GTPase-activating protein domain in its tail.. J. Cell Sci. 109: 653 — 661.  PubMed
  • Post P.L., Bokoch G.M., Mooseker M.S. (1998). Human myosin-IXb is a mechanochemically active motor and a GAP for rho.. J. Cell Sci. 111: 941 — 950.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7609 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q13459 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати