Відкрити головне меню

KEL (англ. Kell blood group, metallo-endopeptidase) – білок, який кодується однойменним геном, розташованим у людей на 7-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 732 амінокислот, а молекулярна маса — 82 824[4].

KEL
Ідентифікатори
Символи KEL, CD238, ECE3, Kell Blood Group Antigen, Kell Blood Group Glycoprotein, EC 3.4.24, Kell Blood Group, Metalloendopeptidase, Kell Blood Group, Kell blood group, metallo-endopeptidase, Kell metallo-endopeptidase (Kell blood group)
Зовнішні ІД MGI: 1346053 HomoloGene: 362 GeneCards: KEL
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000420
NM_032540
RefSeq (білок)
NP_000411
NP_115929
Локус (UCSC) Хр. 7: 142.94 – 142.96 Mb Хр. 6: 41.69 – 41.7 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSRPWAVARRVLT
AILILGLLLCFSVLLFYNFQNCGPRPCETSVCLDLRDHYLASGNTSVAPC
TDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQ
FYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQ
YGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREY
LTYLNQLGTLLGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQ
MVTIDQLKEMAPAIDWLSCLQATFTPMSLSPSQSLVVHDVEYLKNMSQLV
EEMLLKQRDFLQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPP
MPARPRWMKCVEETGTFFEPTLAALFVREAFGPSTRSAAMKLFTAIRDAL
ITRLRNLPWMNEETQNMAQDKVAQLQVEMGASEWALKPELARQEYNDIQL
GSSFLQSVLSCVRSLRARIVQSFLQPHPQHRWKVSPWDVNAYYSVSDHVV
VFPAGLLQPPFFHPGYPRAVNFGAAGSIMAHELLHIFYQLLLPGGCLACD
NHALQEAHLCLKRHYAAFPLPSRTSFNDSLTFLENAADVGGLAIALQAYS
KRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLR
VHGPLSSTPAFARYFRCARGALLNPSSRCQLW

Кодований геном білок за функціями належить до гідролаз, протеаз, металопротеаз, фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Lee S., Zambas E.D., Marsh W.L., Redman C.M. (1991). Molecular cloning and primary structure of Kell blood group protein.. Proc. Natl. Acad. Sci. U.S.A. 88: 6353 — 6357.  PubMed DOI:10.1073/pnas.88.14.6353
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee S., Wu X., Reid M.E., Redman C.M. (1995). Molecular basis of the K:6,-7 [Js(a+b-)] phenotype in the Kell blood group system.. Transfusion 35: 822 — 825.  PubMed DOI:10.1046/j.1537-2995.1995.351096026362.x
  • Russo D., Redman C., Lee S. (1998). Association of XK and Kell blood group proteins.. J. Biol. Chem. 273: 13950 — 13956.  PubMed DOI:10.1074/jbc.273.22.13950
  • Lee S., Naime D., Reid M., Redman C. (1997). The KEL24 and KEL14 alleles of the Kell blood group system.. Transfusion 37: 1035 — 1038.  PubMed DOI:10.1046/j.1537-2995.1997.371098016441.x
  • Lee S., Zambas E., Green E.D., Redman C.M. (1995). Organization of the gene encoding the human Kell blood group protein.. Blood 85: 1364 — 1370.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6308 (англ.). Процитовано 19 вересня 2017. 
  4. UniProt, P23276 (англ.). Процитовано 19 вересня 2017. 

Див. такожРедагувати