Відкрити головне меню

KCNJ11 (англ. Potassium voltage-gated channel subfamily J member 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 390 амінокислот, а молекулярна маса — 43 541[6].

KCNJ11
Ідентифікатори
Символи KCNJ11, BIR, HHF2, IKATP, KIR6.2, MODY13, PHHI, TNDM3, potassium voltage-gated channel subfamily J member 11, potassium inwardly rectifying channel subfamily J member 11
Зовнішні ІД OMIM: 600937 MGI: 107501 HomoloGene: 441 GeneCards: KCNJ11
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу, permanent neonatal diabetes mellitus, maturity-onset diabetes of the young type 13[1]
Реагує на сполуку
Міноксидил, Нікорандил, Глібенкламід, tolbutamide[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000525
NM_001166290
NM_001204411
NM_010602
RefSeq (білок)
NP_000516
NP_001159762
NP_001191340
NP_034732
Локус (UCSC) Хр. 11: 17.39 – 17.39 Mb Хр. 7: 46.09 – 46.1 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIR
EQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDL
APSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILI
VQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFML
RVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIF
LVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLD
EDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS

Кодований геном білок за функціями належить до іонних каналів, потенціалзалежних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт калію. Білок має сайт для зв'язування з калію. Локалізований у мембрані.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Babenko A.P., Gonzalez G., Aguilar-Bryan L., Bryan J. (1998). Reconstituted human cardiac KATP channels: functional identity with the native channels from the sarcolemma of human ventricular cells.. Circ. Res. 83: 1132 — 1143.  PubMed DOI:10.1161/01.RES.83.11.1132
  • Ribalet B., John S.A., Weiss J.N. (2003). Molecular basis for Kir6.2 channel inhibition by adenine nucleotides.. Biophys. J. 84: 266 — 276.  PubMed DOI:10.1016/S0006-3495(03)74847-4
  • Meissner T., Beinbrech B., Mayatepek E. (1999). Congenital hyperinsulinism: molecular basis of a heterogeneous disease.. Hum. Mutat. 13: 351 — 361.  PubMed DOI:10.1002/(SICI)1098-1004(1999)13:5<351::AID-HUMU3>3.0.CO;2-R
  • Tammaro P., Ashcroft F.M. (2007). A mutation in the ATP-binding site of the Kir6.2 subunit of the KATP channel alters coupling with the SUR2A subunit.. J. Physiol. (Lond.) 584: 743 — 753.  PubMed DOI:10.1113/jphysiol.2007.143149
  • Lin Y.F., Chai Y. (2008). Functional modulation of the ATP-sensitive potassium channel by extracellular signal-regulated kinase-mediated phosphorylation.. Neuroscience 152: 371 — 380.  PubMed DOI:10.1016/j.neuroscience.2008.01.003

ПриміткиРедагувати

Див. такожРедагувати