ITGAM (англ. Integrin subunit alpha M) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 152 амінокислот, а молекулярна маса — 127 179[5].

ITGAM
Protein ITGAM PDB 1bho.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ITGAM, CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6, integrin subunit alpha M
Зовнішні ІД OMIM: 120980 MGI: 96607 HomoloGene: 526 GeneCards: ITGAM
Пов'язані генетичні захворювання
системний червоний вовчак[1]
Шаблон експресії
PBB GE ITGAM 205786 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000632
NM_001145808
NM_001082960
NM_008401
RefSeq (білок)
NP_000623
NP_001139280
н/д
Локус (UCSC) Хр. 16: 31.26 – 31.33 Mb Хр. 7: 128.06 – 128.12 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGA
PQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP
QLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSD
IAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHF
TFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAF
KILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM
SQEGFSAAITSNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMN
DAYLGYAAAIILRNRVQSLVLGAPRYQHIGLVAMFRQNTGMWESNANVKG
TQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGR
ARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRG
AVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGE
VRVCLHVQKSTRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRR
QTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRP
VLAEDAQRLFTALFPFEKNCGNDNICQDDLSITFSFMSLDCLVVGGPREF
NVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQRSWRLACESA
SSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRV
MQHQYQVSNLGQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHT
KERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGN
LSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPF
EVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDMMSEGGPPGAE
PQ

Кодований геном білок за функціями належить до рецепторів, інтегринів. Задіяний у таких біологічних процесах, як клітинна адгезія, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію, іоном магнію. Локалізований у мембрані.

ЛітератураРедагувати

  • Arnaout M.A., Remold-O'Donnell E., Pierce M.W., Harris P., Tenen D.G. (1988). Molecular cloning of the alpha subunit of human and guinea pig leukocyte adhesion glycoprotein Mo1: chromosomal localization and homology to the alpha subunits of integrins.. Proc. Natl. Acad. Sci. U.S.A. 85: 2776 — 2780.  PubMed DOI:10.1073/pnas.85.8.2776
  • Arnaout M.A., Gupta S.K., Pierce M.W., Tenen D.G. (1988). Amino acid sequence of the alpha subunit of human leukocyte adhesion receptor Mo1 (complement receptor type 3).. J. Cell Biol. 106: 2153 — 2158.  PubMed DOI:10.1083/jcb.106.6.2153
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Shelley C.S., Arnaout M.A. (1991). The promoter of the CD11b gene directs myeloid-specific and developmentally regulated expression.. Proc. Natl. Acad. Sci. U.S.A. 88: 10525 — 10529.  PubMed DOI:10.1073/pnas.88.23.10525
  • Pierce M.W., Remold-O'Donnell E., Todd R.F. III, Arnaout M.A. (1986). N-terminal sequence of human leukocyte glycoprotein Mo1: conservation across species and homology to platelet IIb/IIIa.. Biochim. Biophys. Acta 874: 368 — 371.  PubMed DOI:10.1016/0167-4838(86)90037-3
  • Lee J.O., Rieu P., Arnaout M.A., Liddington R. (1995). Crystal structure of the A domain from the alpha subunit of integrin CR3 (CD11b/CD18).. Cell 80: 631 — 638.  PubMed DOI:10.1016/0092-8674(95)90517-0

ПриміткиРедагувати

Див. такожРедагувати