Відкрити головне меню

ITGA11 (англ. Integrin subunit alpha 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 188 амінокислот, а молекулярна маса — 133 470[5].

ITGA11
Ідентифікатори
Символи ITGA11, HsT18964, integrin subunit alpha 11
Зовнішні ІД OMIM: 604042 MGI: 2442114 HomoloGene: 8151 GeneCards: ITGA11
Пов'язані генетичні захворювання
Значний депресивний розлад, Синдром порушення активності та уваги, unipolar depression[1]
Шаблон експресії
PBB GE ITGA11 gnf1h00121 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001004439
NM_012211
NM_176922
RefSeq (білок)
NP_001004439
н/д
Локус (UCSC) Хр. 15: 68.3 – 68.43 Mb Хр. 9: 62.68 – 62.78 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDI
SGNKWLVVGAPLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERK
DNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCSRVNSNFRFSK
TVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQ
VGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFAR
SEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIF
SLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSA
GKVIPLRESYLKEFPEELKNHGAYLGYTVTSVVSSRQGRVYVAGAPRFNH
TGKVILFTMHNNRSLTIHQAMRGQQIGSYFGSEITSVDIDGDGVTDVLLV
GAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNARFGSSIASVR
DLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPS
KINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDER
RYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFHVLDTADYVKPVTFSV
EYSLEDPDHGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLVLDARSDLP
TAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGEN
AYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFH
LKYEADVLFTRSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPI
HGMMMKITIPIATRSGNRLLKLRDFLTDEANTSCNIWGNSTEYRPTPVEE
DLRRAPQLNHSNSDVVSINCNIRLVPNQEINFHLLGNLWLRSLKALKYKS
MKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQVPIWIIVGSTL
GGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE

Кодований геном білок за функціями належить до рецепторів, інтегринів. Задіяний у таких біологічних процесах, як клітинна адгезія, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію, іоном магнію. Локалізований у мембрані.

ЛітератураРедагувати

  • Velling T., Kusche-Gullberg M., Sejersen T., Gullberg D. (1999). cDNA cloning and chromosomal localization of human alpha(11) integrin. A collagen-binding, I domain-containing, beta(1)-associated integrin alpha-chain present in muscle tissues.. J. Biol. Chem. 274: 25735 — 25742.  PubMed DOI:10.1074/jbc.274.36.25735

ПриміткиРедагувати

Див. такожРедагувати