IGLL1

білок-кодуючий ген Homo Sapiens

IGLL1 (англ. Immunoglobulin lambda like polypeptide 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 213 амінокислот, а молекулярна маса — 22 963[4].

IGLL1
Protein IGLL1 PDB 2h32.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IGLL1, 14.1, AGM2, CD179b, IGL1, IGL5, IGLJ14.1, IGLL, IGO, IGVPB, VPREB2, immunoglobulin lambda like polypeptide 1
Зовнішні ІД OMIM: 146770 MGI: 96529 HomoloGene: 131669 GeneCards: IGLL1
Шаблон експресії
PBB GE IGLL1 206660 at fs.png

PBB GE IGLL1 213502 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020070
NM_152855
NM_001369906
NM_001190325
RefSeq (білок)
NP_064455
NP_690594
NP_001356835
NP_001177254
Локус (UCSC) Хр. 22: 23.57 – 23.58 Mb Хр. 16: 16.68 – 16.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRAL
GPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGS
GTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWK
ADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEG
STVEKTVAPAECS

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Секретований назовні.

ЛітератураРедагувати

  • Hollis G.F., Evans R.J., Stafford-Hollis J.M., Korsmeyer S.J., McKearn J.P. (1989). Immunoglobulin lambda light-chain-related genes 14.1 and 16.1 are expressed in pre-B cells and may encode the human immunoglobulin omega light-chain protein.. Proc. Natl. Acad. Sci. U.S.A. 86: 5552 — 5556.  PubMed DOI:10.1073/pnas.86.14.5552
  • Evans R.J., Hollis G.F. (1991). Genomic structure of the human Ig lambda 1 gene suggests that it may be expressed as an Ig lambda 14.1-like protein or as a canonical B cell Ig lambda light chain: implications for Ig lambda gene evolution.. J. Exp. Med. 173: 305 — 311.  PubMed DOI:10.1084/jem.173.2.305
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5870 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P15814 (англ.). Архів оригіналу за 9 квітня 2013. Процитовано 12 вересня 2017. 

Див. такожРедагувати