Відкрити головне меню

HRH4 (англ. Histamine receptor H4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 390 амінокислот, а молекулярна маса — 44 496[5].

HRH4
Ідентифікатори
Символи HRH4, AXOR35, BG26, GPCR105, GPRv53, H4, H4R, HH4R, histamine receptor H4
Зовнішні ІД OMIM: 606792 MGI: 2429635 HomoloGene: 11002 GeneCards: HRH4
Реагує на сполуку
4-methylhistamine, dimaprit, Гістамін, HTMT, imetit, Immepip, methimepip, VUF 8430, clobenpropit, impromidine, ciproxifan, clozapine, conessine, JNJ-10191584, JNJ-7777120, MK-0249, pitolisant, thioperamide[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001143828
NM_001160166
NM_021624
NM_153087
RefSeq (білок)
NP_001137300
NP_001153638
NP_067637
NP_694727
Локус (UCSC) Хр. 18: 24.46 – 24.48 Mb Хр. 18: 13.01 – 13.02 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRS
SYFFLNLAISDFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTA
SVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVWVLAFLVNGPM
ILVSESWKDEGSECEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWS
LWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHS
ERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFN
SFVNPLLYPLCHKRFQKAFLKIFCIKKQPLPSQHSRSVSS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • Oda T., Morikawa N., Saito Y., Masuho Y., Matsumoto S. (2000). Molecular cloning and characterization of a novel type of histamine receptor preferentially expressed in leukocytes.. J. Biol. Chem. 275: 36781 — 36786.  PubMed DOI:10.1074/jbc.M006480200
  • Nakamura T., Itadani H., Hidaka Y., Ohta M., Tanaka K. (2000). Molecular cloning and characterization of a new human histamine receptor, HH4R.. Biochem. Biophys. Res. Commun. 279: 615 — 620.  PubMed DOI:10.1006/bbrc.2000.4008
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

Див. такожРедагувати