HLA-DRB1

білок-кодуючий ген Homo Sapiens

HLA-DRB1 (англ. HLA class II histocompatibility antigen, DRB1-15 beta chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 266 амінокислот, а молекулярна маса — 29 966[3].

HLA-DRB1
1AQD.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи HLA-DRB1, DRB1, DRw10, HLA-DR1B, HLA-DRB, SS1, major histocompatibility complex, class II, DR beta 1
Зовнішні ІД OMIM: 142857 HomoloGene: 136635 GeneCards: HLA-DRB1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243965
NM_002124
NM_001359193
NM_001359194
н/д
RefSeq (білок)
NP_001230894
NP_002115
NP_001346122
NP_001346123
NP_002115.2
н/д
Локус (UCSC) Хр. 6: 32.58 – 32.59 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGT
ERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQA
RAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSG
FYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS

Задіяний у такому біологічному процесі, як імунітет. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі, лізосомі, апараті гольджі, ендосомах.

ЛітератураРедагувати

  • Lock C.B., So A.K., Welsh K.I., Parkes J.D., Trowsdale J. (1988). MHC class II sequences of an HLA-DR2 narcoleptic.. Immunogenetics 27: 449 — 455.  PubMed DOI:10.1007/BF00364432
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee B.S.M., Rust N.A., McMichael A.J., McDevitt H.O. (1987). HLA-DR2 subtypes form an additional supertypic family of DR beta alleles.. Proc. Natl. Acad. Sci. U.S.A. 84: 4591 — 4595.  PubMed DOI:10.1073/pnas.84.13.4591
  • Cresswell P. (1996). Invariant chain structure and MHC class II function.. Cell 84: 505 — 507.  PubMed DOI:10.1016/S0092-8674(00)81025-9
  • Villadangos J.A. (2001). Presentation of antigens by MHC class II molecules: getting the most out of them.. Mol. Immunol. 38: 329 — 346.  PubMed DOI:10.1016/S0161-5890(01)00069-4
  • Menendez-Benito V., Neefjes J. (2007). Autophagy in MHC class II presentation: sampling from within.. Immunity 26: 1 — 3.  PubMed DOI:10.1016/j.immuni.2007.01.005

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:4948 (англ.). Процитовано 6 вересня 2017. 
  3. UniProt, P01911 (англ.). Процитовано 6 вересня 2017. 

Див. такожРедагувати