Відкрити головне меню

HLA-A (англ. HLA class I histocompatibility antigen, A-3 alpha chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 365 амінокислот, а молекулярна маса — 40 841[4].

HLA-A
HLA-A*02 protein structure.jpg
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи HLA-A, Aw-33, Aw-74, major histocompatibility complex, class I, A, HLA-A11, HLA-A33, HLA-DQB1, HLA-DRB1
Зовнішні ІД OMIM: 142800 MGI: 95931 HomoloGene: 128352 GeneCards: HLA-A
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001242758
NM_002116
NM_010392
NM_001368740
RefSeq (білок)
NP_001229687
NP_002107
NP_001229687.1
н/д
Локус (UCSC) Хр. 6: 29.94 – 29.95 Mb Хр. 17: 35.34 – 35.35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVG
YVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRV
DLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
NEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGK
ETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQ
DTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASS
DSAQGSDVSLTACKV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, взаємодія хазяїн-вірус. Локалізований у мембрані.

ЛітератураРедагувати

  • Strachan T., Sodoyer R., Damotte M., Jordan B.R. (1984). Complete nucleotide sequence of a functional class I HLA gene, HLA-A3: implications for the evolution of HLA genes.. EMBO J. 3: 887 — 894.  PubMed
  • Cowan E.P., Jordan B.E., Coligan J.E. (1985). Molecular cloning and DNA sequence analysis of genes encoding cytotoxic T lymphocyte-defined HLA-A3 subtypes: the E1 subtype.. J. Immunol. 135: 2835 — 2841.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4931 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P04439 (англ.). Процитовано 6 вересня 2017. 

Див. такожРедагувати