Гексозамінідаза A

білок-кодуючий ген Homo Sapiens
(Перенаправлено з HEXA)

HEXA (англ. Hexosaminidase subunit alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 529 амінокислот, а молекулярна маса — 60 703[5].

HEXA
Protein HEXA PDB 2gjx.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HEXA, TSD, hexosaminidase subunit alpha
Зовнішні ІД OMIM: 606869 MGI: 96073 HomoloGene: 20146 GeneCards: HEXA
Пов'язані генетичні захворювання
Хвороба Тея-Сакса[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000520
NM_001318825
NM_010421
RefSeq (білок)
NP_000511
NP_001305754
NP_034551
Локус (UCSC) Хр. 15: 72.34 – 72.38 Mb Хр. 9: 59.54 – 59.57 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDV
SSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVV
TPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSA
EGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNV
FHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRG
IRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQ
LESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNY
MKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKA
LVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERL
SHFRCELLRRGVQAQPLNVGFCEQEFEQT

Кодований геном білок за функціями належить до гідролаз, глікозидаз. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у лізосомі.

ЛітератураРедагувати

  • Myerowitz R., Piekarz R., Neufeld E.F., Shows T.B., Suzuki K. (1985). Human beta-hexosaminidase alpha chain: coding sequence and homology with the beta chain.. Proc. Natl. Acad. Sci. U.S.A. 82: 7830 — 7834.  PubMed DOI:10.1073/pnas.82.23.7830
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • O'Dowd B.F., Cumming D.A., Gravel R.A., Mahuran D.J. (1988). Oligosaccharide structure and amino acid sequence of the major glycopeptides of mature human beta-hexosaminidase.. Biochemistry 27: 5216 — 5226.  PubMed DOI:10.1021/bi00414a041
  • Tse R., Vavougios G., Hou Y., Mahuran D.J. (1996). Identification of an active acidic residue in the catalytic site of beta-hexosaminidase.. Biochemistry 35: 7599 — 7607.  PubMed DOI:10.1021/bi960246+
  • Mahuran D.J. (1991). The biochemistry of HEXA and HEXB gene mutations causing GM2 gangliosidosis.. Biochim. Biophys. Acta 1096: 87 — 94.  PubMed DOI:10.1016/0925-4439(91)90044-A
  • Myerowitz R. (1997). Tay-Sachs disease-causing mutations and neutral polymorphisms in the Hex A gene.. Hum. Mutat. 9: 195 — 208.  PubMed DOI:10.1002/(SICI)1098-1004(1997)9:3<195::AID-HUMU1>3.0.CO;2-7

ПриміткиРедагувати

Див. такожРедагувати