GTF2B (англ. General transcription factor IIB) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 316 амінокислот, а молекулярна маса — 34 833[5].

GTF2B
Protein GTF2B PDB 1c9b.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2B, TF2B, TFIIB, general transcription factor IIB
Зовнішні ІД OMIM: 189963 MGI: 2385191 HomoloGene: 1158 GeneCards: GTF2B
Пов'язані генетичні захворювання
ожиріння[1]
Шаблон експресії
PBB GE GTF2B 208066 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001514
NM_145546
RefSeq (білок)
NP_001505
NP_663521
Локус (UCSC) Хр. 1: 88.85 – 88.89 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGS
EWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSK
YQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKS
LKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILK
ALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSP
ISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL

Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

ЛітератураРедагувати

  • Ha I., Lane W.S., Reinberg D. (1991). Cloning of a human gene encoding the general transcription initiation factor IIB.. Nature 352: 689 — 695.  PubMed DOI:10.1038/352689a0
  • Malik S., Hisatake K., Sumimoto H., Horikoshi M., Roeder R.G. (1991). Sequence of general transcription factor TFIIB and relationships to other initiation factors.. Proc. Natl. Acad. Sci. U.S.A. 88: 9553 — 9557.  PubMed DOI:10.1073/pnas.88.21.9553
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Umehara T., Kida S., Yamamoto T., Horikoshi M. (1995). Isolation and characterization of a cDNA encoding a new type of human transcription elongation factor S-II.. Gene 167: 297 — 302.  PubMed DOI:10.1016/0378-1119(95)00634-6
  • Yuan C.X., Gurley W.B. (2000). Potential targets for HSF1 within the preinitiation complex.. Cell Stress Chaperones 5: 229 — 242.  PubMed DOI:10.1379/1466-1268(2000)005<0229:PTFHWT>2.0.CO;2
  • Chen H.T., Legault P., Glushka J., Omichinski J.G., Scott R.A. (2000). Structure of a (Cys3His) zinc ribbon, a ubiquitous motif in archaeal and eucaryal transcription.. Protein Sci. 9: 1743 — 1752.  PubMed DOI:10.1110/ps.9.9.1743

ПриміткиРедагувати

Див. такожРедагувати