Відкрити головне меню

GRIK1 (англ. Glutamate ionotropic receptor kainate type subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 918 амінокислот, а молекулярна маса — 103 981[6].

GRIK1
Protein GRIK1 PDB 1txf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GRIK1, EAA3, EEA3, GLR5, GLUR5, GluK1, gluR-5, glutamate ionotropic receptor kainate type subunit 1
Зовнішні ІД OMIM: 138245 MGI: 95814 HomoloGene: 68992 GeneCards: GRIK1
Пов'язані генетичні захворювання
періодонтит, hepatocellular carcinoma, рак молочної залози[1]
Реагує на сполуку
Iodo-Willardiine, ACET (речовина), UBP310[2]
Шаблон експресії
PBB GE GRIK1 207242 s at fs.png

PBB GE GRIK1 214611 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_010348
NM_146072
NM_001346964
RefSeq (білок)
н/д
Локус (UCSC) Хр. 21: 29.54 – 29.94 Mb Хр. 16: 87.9 – 88.29 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEP
VNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQL
ALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINL
YPDYAAISRAILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKI
KIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMT
EYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHR
HKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGT
EKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLI
VTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVP
DGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMT
LGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRI
VGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAV
RDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYAL
LMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQL
QEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFIVLAAGLVLSV
FVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV

Кодований геном білок за функціями належить до рецепторів, іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

ЛітератураРедагувати

  • Gregor P., O'Hara B.F., Yang X., Uhl G.R. (1993). Expression and novel subunit isoforms of glutamate receptor genes GluR5 and GluR6.. NeuroReport 4: 1343 — 1346.  PubMed
  • Nutt S.L., Kamboj R.K. (1994). RNA editing of human kainate receptor subunits.. NeuroReport 5: 2625 — 2629.  PubMed

ПриміткиРедагувати

Див. такожРедагувати