GNA13

білок-кодуючий ген Homo Sapiens

GNA13 (англ. G protein subunit alpha 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 377 амінокислот, а молекулярна маса — 44 050[4].

GNA13
Protein GNA13 PDB 1zcb.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GNA13, G13, G protein subunit alpha 13
Зовнішні ІД OMIM: 604406 MGI: 95768 HomoloGene: 55976 GeneCards: GNA13
Шаблон експресії
PBB GE GNA13 206917 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001282425
NM_006572
NM_010303
NM_001359034
RefSeq (білок)
NP_001269354
NP_006563
NP_034433
NP_001345963
Локус (UCSC) Хр. 17: 65.01 – 65.06 Mb Хр. 11: 109.36 – 109.4 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVK
ILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLV
DAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR
ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLAR
RPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSS
EFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI
NTENIRLVFRDVKDTILHDNLKQLMLQ

Кодований геном білок за функціями належить до білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, іонами металів, ГТФ, іоном магнію. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

ЛітератураРедагувати

  • Kabouridis P.S., Waters S.T., Escobar S., Stanners J., Tsoukas C.D. (1995). Expression of GTP-binding protein alpha subunits in human thymocytes.. Mol. Cell. Biochem. 144: 45 — 51.  PubMed DOI:10.1007/BF00926739
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fukuhara S., Murga C., Zohar M., Igishi T., Gutkind J.S. (1999). A novel PDZ domain containing guanine nucleotide exchange factor links heterotrimeric G proteins to Rho.. J. Biol. Chem. 274: 5868 — 5879.  PubMed DOI:10.1074/jbc.274.9.5868
  • Fukuhara S., Chikumi H., Gutkind J.S. (2000). Leukemia-associated Rho guanine nucleotide exchange factor (LARG) links heterotrimeric G proteins of the G(12) family to Rho.. FEBS Lett. 485: 183 — 188.  PubMed DOI:10.1016/S0014-5793(00)02224-9
  • Bhattacharyya R., Wedegaertner P.B. (2000). Galpha 13 requires palmitoylation for plasma membrane localization, Rho-dependent signaling, and promotion of p115-RhoGEF membrane binding.. J. Biol. Chem. 275: 14992 — 14999.  PubMed DOI:10.1074/jbc.M000415200
  • Meigs T.E., Fedor-Chaiken M., Kaplan D.D., Brackenbury R., Casey P.J. (2002). Galpha12 and Galpha13 negatively regulate the adhesive functions of cadherin.. J. Biol. Chem. 277: 24594 — 24600.  PubMed DOI:10.1074/jbc.M201984200

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4381 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q14344 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати