Відкрити головне меню

GCNT2 (англ. N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 402 амінокислот, а молекулярна маса — 45 873[4].

GCNT2
Ідентифікатори
Символи GCNT2, CCAT, CTRCT13, GCNT2C, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3, bA360O19.2, bA421M1.1, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group), glucosaminyl (N-acetyl) transferase 2 (I blood group)
Зовнішні ІД MGI: 1100870 HomoloGene: 41535 GeneCards: GCNT2
Шаблон експресії
PBB GE GCNT2 gnf1h10485 at fs.png

PBB GE GCNT2 211020 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001491
NM_145649
NM_145655
NM_008105
NM_023887
NM_133219
RefSeq (білок)
NP_032131
NP_076376
NP_573482
Локус (UCSC) Хр. 6: 10.49 – 10.63 Mb Хр. 13: 40.86 – 40.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACH
QIFEGKVFYPTENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYT
VTIHKDFGTFERLFRAIYMPQNVYCVHLDQKATDAFKGAVKQLLSCFPNA
FLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTN
REIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKL
KTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHF
WVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYG
NGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSW
YF

Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у мембрані, апараті гольджі.

ЛітератураРедагувати

  • Bierhuizen M.F.A., Mattei M.-G., Fukuda M. (1993). Expression of the developmental I antigen by a cloned human cDNA encoding a member of a beta-1,6-N-acetylglucosaminyltransferase gene family.. Genes Dev. 7: 468 — 478.  PubMed DOI:10.1101/gad.7.3.468
  • Bierhuizen M.F.A., Maemura K., Kudo S., Fukuda M. (1995). Genomic organization of core 2 and I branching beta-1,6-N-acetylglucosaminyltransferases. Implication for evolution of the beta-1,6-N-acetylglucosaminyltransferase gene family.. Glycobiology 5: 417 — 425.  PubMed DOI:10.1093/glycob/5.4.417
  • Zhang T., Haws P., Wu Q. (2004). Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.. Genome Res. 14: 79 — 89.  PubMed DOI:10.1101/gr.1225204
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yu L.C., Twu Y.C., Chang C.Y., Lin M. (2001). Molecular basis of the adult i phenotype and the gene responsible for the expression of the human blood group I antigen.. Blood 98: 3840 — 3845.  PubMed DOI:10.1182/blood.V98.13.3840

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4204 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q06430 (англ.). Процитовано 6 вересня 2017. 

Див. такожРедагувати