Відкрити головне меню

GABPB1 (англ. GA binding protein transcription factor beta subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 395 амінокислот, а молекулярна маса — 42 483[4].

GABPB1
Protein GABPB2 PDB 1awc.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GABPB1, BABPB2, E4TF1, E4TF1-47, E4TF1-53, E4TF1B, GABPB, GABPB2, NRF2B1, NRF2B2, GABPB-1, GA binding protein transcription factor beta subunit 1, GA binding protein transcription factor subunit beta 1
Зовнішні ІД OMIM: 600610 MGI: 95611 HomoloGene: 7723 GeneCards: GABPB1
Шаблон експресії
PBB GE GABPB2 204618 s at fs.png

PBB GE GABPB2 206173 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 15: 50.28 – 50.36 Mb Хр. 2: 126.63 – 126.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH
YSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAK
DMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNE
DLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSE
NSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEE
VVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT
MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREAL
QKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Локалізований у ядрі.

ЛітератураРедагувати

  • Gugneja S., Virbasius J.V., Scarpulla R.C. (1995). Four structurally distinct, non-DNA-binding subunits of human nuclear respiratory factor 2 share a conserved transcriptional activation domain.. Mol. Cell. Biol. 15: 102 — 111.  PubMed DOI:10.1128/MCB.15.1.102
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Virbasius J.V., Virbasius C.A., Scarpulla R.C. (1993). Identity of GABP with NRF-2, a multisubunit activator of cytochrome oxidase expression, reveals a cellular role for an ETS domain activator of viral promoters.. Genes Dev. 7: 380 — 392.  PubMed DOI:10.1101/gad.7.3.380
  • Gugneja S., Virbasius C.M., Scarpulla R.C. (1996). Nuclear respiratory factors 1 and 2 utilize similar glutamine-containing clusters of hydrophobic residues to activate transcription.. Mol. Cell. Biol. 16: 5708 — 5716.  PubMed DOI:10.1128/MCB.16.10.5708
  • Vogel J.L., Kristie T.M. (2000). The novel coactivator C1 (HCF) coordinates multiprotein enhancer formation and mediates transcription activation by GABP.. EMBO J. 19: 683 — 690.  PubMed DOI:10.1093/emboj/19.4.683

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4074 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q06547 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати