Відкрити головне меню

EXOSC3 (англ. Exosome component 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 275 амінокислот, а молекулярна маса — 29 572[5].

EXOSC3
Protein EXOSC3 PDB 2nn6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EXOSC3, PCH1B, RRP40, Rrp40p, bA3J10.7, hRrp-40, p10, CGI-102, Exosome component 3
Зовнішні ІД OMIM: 606489 MGI: 1913612 HomoloGene: 6867 GeneCards: EXOSC3
Пов'язані генетичні захворювання
pontocerebellar hypoplasia type 1B[1]
Шаблон експресії
PBB GE EXOSC3 gnf1h00198 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016042
NM_001002269
NM_025513
NM_001362788
RefSeq (білок)
NP_001002269
NP_057126
NP_079789
NP_001349717
Локус (UCSC) Хр. 9: 37.77 – 37.8 Mb Хр. 4: 45.32 – 45.34 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVE
RPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVY
WVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGAT
KRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLF
KVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLIL
ANILEACEHMTSDQRKQIFSRLAES

Задіяний у таких біологічних процесах, як процесінг рРНК, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з РНК. Локалізований у цитоплазмі, ядрі, екзосомі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. (2000). Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.. Genome Res. 10: 703 — 713.  PubMed DOI:10.1101/gr.10.5.703
  • van Dijk E.L., Schilders G., Pruijn G.J. (2007). Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways.. RNA 13: 1027 — 1035.  PubMed DOI:10.1261/rna.575107
  • Chen G., Guo X., Lv F., Xu Y., Gao G. (2008). p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein.. Proc. Natl. Acad. Sci. U.S.A. 105: 4352 — 4357.  PubMed DOI:10.1073/pnas.0712276105
  • Liu Q., Greimann J.C., Lima C.D. (2006). Reconstitution, activities, and structure of the eukaryotic RNA exosome.. Cell 127: 1223 — 1237.  PubMed DOI:10.1016/j.cell.2006.10.037
  • Liu Q., Greimann J.C., Lima C.D. (2007). Cell 131: 188 — 189. 

ПриміткиРедагувати

Див. такожРедагувати