Відкрити головне меню

EXOSC2 (англ. Exosome component 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 293 амінокислот, а молекулярна маса — 32 789[4].

EXOSC2
Protein EXOSC2 PDB 2nn6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EXOSC2, RRP4, Rrp4p, hRrp4p, p7, Exosome component 2, SHRF
Зовнішні ІД OMIM: 602238 MGI: 2385133 HomoloGene: 6095 GeneCards: EXOSC2
Шаблон експресії
PBB GE EXOSC2 214507 s at fs.png

PBB GE EXOSC2 209527 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001282708
NM_001282709
NM_014285
NM_144886
RefSeq (білок)
NP_001269637
NP_001269638
NP_055100
NP_659135
Локус (UCSC) Хр. 9: 130.69 – 130.7 Mb Хр. 2: 31.67 – 31.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEE
KLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVET
NSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFS
DGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNN
GFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMM
LYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як процесінг рРНК, альтернативний сплайсинг. Білок має сайт для зв'язування з РНК. Локалізований у цитоплазмі, ядрі, екзосомі.

ЛітератураРедагувати

  • Mitchell P., Petfalski E., Shevchenko A., Mann M., Tollervey D. (1997). The exosome: a conserved eukaryotic RNA processing complex containing multiple 3'-->5' exoribonucleases.. Cell 91: 457 — 466.  PubMed DOI:10.1016/S0092-8674(00)80432-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mitchell P., Petfalski E., Tollervey D. (1996). The 3' end of yeast 5.8S rRNA is generated by an exonuclease processing mechanism.. Genes Dev. 10: 502 — 513.  PubMed DOI:10.1101/gad.10.4.502
  • Lykke-Andersen J., Wagner E. (2005). Recruitment and activation of mRNA decay enzymes by two ARE-mediated decay activation domains in the proteins TTP and BRF-1.. Genes Dev. 19: 351 — 361.  PubMed DOI:10.1101/gad.1282305
  • van Dijk E.L., Schilders G., Pruijn G.J. (2007). Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways.. RNA 13: 1027 — 1035.  PubMed DOI:10.1261/rna.575107
  • Liu Q., Greimann J.C., Lima C.D. (2006). Reconstitution, activities, and structure of the eukaryotic RNA exosome.. Cell 127: 1223 — 1237.  PubMed DOI:10.1016/j.cell.2006.10.037

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17097 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q13868 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати