EIF2S2 (англ. Eukaryotic translation initiation factor 2 subunit beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 333 амінокислот, а молекулярна маса — 38 388[4].

EIF2S2
Ідентифікатори
Символи EIF2S2, EIF2, EIF2B, EIF2beta, PPP1R67, eIF-2-beta, eukaryotic translation initiation factor 2 subunit beta
Зовнішні ІД OMIM: 603908 MGI: 1914454 HomoloGene: 2904 GeneCards: EIF2S2
Шаблон експресії
PBB GE EIF2S2 208726 s at fs.png

PBB GE EIF2S2 208725 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003908
NM_001316363
NM_001316364
NM_026030
RefSeq (білок)
NP_001303292
NP_001303293
NP_003899
NP_080306
Локус (UCSC) Хр. 20: 34.09 – 34.11 Mb Хр. 2: 154.71 – 154.73 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTE
DKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
LKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDED
NKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKR
KFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSI
DGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

Кодований геном білок за функцією належить до факторів ініціації. Задіяний у такому біологічному процесі як біосинтез білка. Білок має сайт для зв'язування з іонами металів, іоном цинку.

ЛітератураРедагувати

  • Pathak V.K., Nielsen P.J., Trachsel H., Hershey J.W.B. (1988). Structure of the beta subunit of translational initiation factor eIF-2.. Cell 54: 633 — 639.  PubMed DOI:10.1016/S0092-8674(88)80007-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3266 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P20042 (англ.). Архів оригіналу за 26 березня 2017. Процитовано 21 серпня 2017. 

Див. такожРедагувати