Відкрити головне меню

EID1

білок-кодуючий ген Homo Sapiens

EID1 (англ. EP300 interacting inhibitor of differentiation 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 187 амінокислот, а молекулярна маса — 20 876[4].

EID1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EID1, C15orf3, CRI1, EID-1, IRO45620, PTD014, RBP21, PNAS-22, EP300 interacting inhibitor of differentiation 1
Зовнішні ІД OMIM: 605894 MGI: 1889651 HomoloGene: 49376 GeneCards: EID1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014335
NM_025613
RefSeq (білок)
NP_055150
NP_079889
Локус (UCSC) Хр. 15: 48.88 – 48.88 Mb Хр. 2: 125.67 – 125.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQ
QLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGE
EFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMH
YEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, диференціація клітин, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

ЛітератураРедагувати

  • MacLellan W.R., Xiao G., Abdellatif M., Schneider M.D. (2000). A novel Rb- and p300-binding protein inhibits transactivation by MyoD.. Mol. Cell. Biol. 20: 8903 — 8915.  PubMed DOI:10.1128/MCB.20.23.8903-8915.2000
  • Wen H., Ao S. (2001). Identification and characterization of a novel human cDNA encoding a 21 kDa pRb-associated protein.. Gene 263: 85 — 92.  PubMed DOI:10.1016/S0378-1119(00)00585-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1191 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9Y6B2 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати