Відкрити головне меню

EHD4 (англ. EH domain containing 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 541 амінокислот, а молекулярна маса — 61 175[4].

EHD4
Ідентифікатори
Символи EHD4, PAST4, EH domain containing 4
Зовнішні ІД MGI: 1919619 HomoloGene: 26430 GeneCards: EHD4
Шаблон експресії
PBB GE EHD4 209536 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_139265
NM_133838
RefSeq (білок)
NP_644670
NP_598599
Локус (UCSC) Хр. 15: 41.9 – 41.97 Mb Хр. 2: 120.09 – 120.15 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHS
PALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSF
IAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLK
SISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDIS
DEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTP
EVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQ
ISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLI
SQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPV
YDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLD
EEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, іоном кальцію. Локалізований у клітинній мембрані, мембрані, ендосомах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sharma M., Naslavsky N., Caplan S. (2008). A role for EHD4 in the regulation of early endosomal transport.. Traffic 9: 995 — 1018.  PubMed DOI:10.1111/j.1600-0854.2008.00732.x

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3245 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9H223 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати