Відкрити головне меню

EDC3 (англ. Enhancer of mRNA decapping 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 508 амінокислот, а молекулярна маса — 56 078[4].

EDC3
Protein EDC3 PDB 2VC8.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EDC3, LSM16, YJDC, YJEFN2, MRT50, enhancer of mRNA decapping 3, hYjeF_N2-15q23
Зовнішні ІД MGI: 2142951 HomoloGene: 11827 GeneCards: EDC3
Шаблон експресії
PBB GE EDC3 219207 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001142443
NM_001142444
NM_025083
NM_001351378
NM_001351379
NM_153799
RefSeq (білок)
NP_001135915
NP_001135916
NP_079359
NP_001338307
NP_001338308
NP_722494
Локус (UCSC) Хр. 15: 74.63 – 74.7 Mb Хр. 9: 57.71 – 57.75 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVP
EVTFRAGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGT
GKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKSYVDRHMESLS
QSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIP
DTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENI
LESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLT
LERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG
ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLP
TSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVE
QGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCK
FVIPLHSA

Кодований геном білок за функцією належить до фосфопротеїнів. Білок має сайт для зв'язування з РНК. Локалізований у цитоплазмі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fenger-Groen M., Fillman C., Norrild B., Lykke-Andersen J. (2005). Multiple processing body factors and the ARE binding protein TTP activate mRNA decapping.. Mol. Cell 20: 905 — 915.  PubMed DOI:10.1016/j.molcel.2005.10.031
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:26114 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q96F86 (англ.). Процитовано 11 вересня 2017. 

Див. такожРедагувати