Відкрити головне меню

DBNL (англ. Drebrin like) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 430 амінокислот, а молекулярна маса — 48 207[4].

DBNL
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DBNL, ABP1, HIP-55, HIP55, SH3P7, Drebrin-like, drebrin like
Зовнішні ІД MGI: 700006 HomoloGene: 8468 GeneCards: DBNL
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001146308
NM_001146309
NM_013810
RefSeq (білок)
NP_001139780
NP_001139781
NP_038838
Локус (UCSC) Хр. 7: 44.04 – 44.07 Mb Хр. 11: 5.79 – 5.8 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGL
EEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASH
VSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQ
DVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEE
AQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNE
QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
PAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLV
QQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITG
IEVIDEGWWRGYGPDGHFGMFPANYVELIE

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як адаптивний імунітет, імунітет, транспорт, ендоцитоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, клітинних відростках, цитоплазматичних везикулах, апараті гольджі, синапсах, ендосомах.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Larbolette O., Wollscheid B., Schweikert J., Nielsen P.J., Wienands J. (1999). SH3P7 is a cytoskeleton adapter protein and is coupled to signal transduction from lymphocyte antigen receptors.. Mol. Cell. Biol. 19: 1539 — 1546.  PubMed DOI:10.1128/MCB.19.2.1539
  • Chen Y.-R., Kori R., John B., Tan T.-H. (2001). Caspase-mediated cleavage of actin-binding and SH3-domain-containing proteins cortactin, HS1, and HIP-55 during apoptosis.. Biochem. Biophys. Res. Commun. 288: 981 — 989.  PubMed DOI:10.1006/bbrc.2001.5862
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2696 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q9UJU6 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати