Відкрити головне меню

CYP2R1 (англ. Cytochrome P450 family 2 subfamily R member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 501 амінокислот, а молекулярна маса — 57 359[5].

CYP2R1
Protein CYP2R1 PDB 2ojd.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CYP2R1, cytochrome P450 family 2 subfamily R member 1
Зовнішні ІД MGI: 2449771 HomoloGene: 75210 GeneCards: CYP2R1
Пов'язані генетичні захворювання
vitamin metabolic disorder[1]
Шаблон експресії
PBB GE CYP2R1 gnf1h06427 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_024514
NM_177382
RefSeq (білок)
NP_078790
NP_796356
Локус (UCSC) Хр. 11: 14.88 – 14.89 Mb Хр. 7: 114.55 – 114.56 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MWKLWRAEEGAAALGGALFLLLFALGVRQLLKQRRPMGFPPGPPGLPFIG
NIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLV
HQSEIFADRPCLPLFMKMTKMGGLLNSRYGRGWVDHRRLAVNSFRYFGYG
QKSFESKILEETKFFNDAIETYKGRPFDFKQLITNAVSNITNLIIFGERF
TYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPFGKHQQLFRNA
AVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENL
IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKP
SWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTV
ITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLG
EHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQPQPYLICAER
R

Кодований геном білок за функцією належить до оксидоредуктаз. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом, НАДФ. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Cheng J.B., Motola D.L., Mangelsdorf D.J., Russell D.W. (2003). De-orphanization of cytochrome P450 2R1: a microsomal vitamin D 25-hydroxylase.. J. Biol. Chem. 278: 38084 — 38093.  PubMed DOI:10.1074/jbc.M307028200
  • Shinkyo R., Sakaki T., Kamakura M., Ohta M., Inouye K. (2004). Metabolism of vitamin D by human microsomal CYP2R1.. Biochem. Biophys. Res. Commun. 324: 451 — 457.  PubMed DOI:10.1016/j.bbrc.2004.09.073
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Strushkevich N., Usanov S.A., Plotnikov A.N., Jones G., Park H.-W. (2008). Structural analysis of CYP2R1 in complex with vitamin D3.. J. Mol. Biol. 380: 95 — 106.  PubMed DOI:10.1016/j.jmb.2008.03.065
  • Cheng J.B., Levine M.A., Bell N.H., Mangelsdorf D.J., Russell D.W. (2004). Genetic evidence that the human CYP2R1 enzyme is a key vitamin D 25-hydroxylase.. Proc. Natl. Acad. Sci. U.S.A. 101: 7711 — 7715.  PubMed DOI:10.1073/pnas.0402490101
  • Thacher T.D., Fischer P.R., Singh R.J., Roizen J., Levine M.A. (2015). CYP2R1 mutations impair generation of 25-hydroxyvitamin D and cause an atypical form of vitamin D deficiency.. J. Clin. Endocrinol. Metab. 100: E1005 — 1013.  PubMed DOI:10.1210/jc.2015-1746

ПриміткиРедагувати

Див. такожРедагувати