Відкрити головне меню

CYP2C9 (англ. Cytochrome P450 family 2 subfamily C member 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 490 амінокислот, а молекулярна маса — 55 628[4].

CYP2C9
CYP2C9 1OG2.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи CYP2C9, CPC9, CYP2C, CYP2C10, CYPIIC9, P450IIC9, cytochrome P450 family 2 subfamily C member 9, Cytochrome P450 2C9
Зовнішні ІД OMIM: 601130 MGI: 1919553 HomoloGene: 133566 GeneCards: CYP2C9
шифр КФ 1.14.13.48
Шаблон експресії
PBB GE CYP2C9 214421 x at fs.png

PBB GE CYP2C9 216025 x at fs.png

PBB GE CYP2C9 216661 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000771
NM_028191
RefSeq (білок)
NP_000762
н/д
Локус (UCSC) Хр. 10: 94.94 – 94.99 Mb Хр. 19: 39.06 – 39.09 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDI
SKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIF
PLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEAR
CLVEELRKTKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEK
LNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKE
HQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDA
VVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKE
FPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRICVGEALAGMELFLFLT
SILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як метаболізм ліпідів, метаболізм стероїдів, метаболізм стеролів, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом, НАДФ. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Kimura S., Pastewka J., Gelboin H.V., Gonzalez F.J. (1987). cDNA and amino acid sequences of two members of the human P450IIC gene subfamily.. Nucleic Acids Res. 15: 10053 — 10054.  PubMed DOI:10.1093/nar/15.23.10053
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Umbenhauer D.R., Martin M.V., Lloyd R.S., Guengerich F.P. (1987). Cloning and sequence determination of a complementary DNA related to human liver microsomal cytochrome P-450 S-mephenytoin 4-hydroxylase.. Biochemistry 26: 1094 — 1099.  PubMed DOI:10.1021/bi00378a016
  • Haining R.L., Hunter A.P., Veronese M.E., Trager W.F., Rettie A.E. (1996). Allelic variants of human cytochrome P450 2C9: baculovirus-mediated expression, purification, structural characterization, substrate stereoselectivity, and prochiral selectivity of the wild-type and I359L mutant forms.. Arch. Biochem. Biophys. 333: 447 — 458.  PubMed DOI:10.1006/abbi.1996.0414
  • Sandhu P., Baba T., Guengerich F.P. (1993). Expression of modified cytochrome P450 2C10 (2C9) in Escherichia coli, purification, and reconstitution of catalytic activity.. Arch. Biochem. Biophys. 306: 443 — 450.  PubMed DOI:10.1006/abbi.1993.1536
  • Miyazawa M., Shindo M., Shimada T. (2002). Metabolism of (+)- and (-)-limonenes to respective carveols and perillyl alcohols by CYP2C9 and CYP2C19 in human liver microsomes.. Drug Metab. Dispos. 30: 602 — 607.  PubMed DOI:10.1124/dmd.30.5.602

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2623 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P11712 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати