Відкрити головне меню

CYP2C8 (англ. Cytochrome P450 family 2 subfamily C member 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 490 амінокислот, а молекулярна маса — 55 825[6].

CYP2C8
Protein CYP2C8 PDB 1pq2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CYP2C8, CPC8, CYPIIC8, MP-12/MP-20, cytochrome P450 family 2 subfamily C member 8, CYP2C8DM
Зовнішні ІД OMIM: 601129 MGI: 1306818 HomoloGene: 117948 GeneCards: CYP2C8
Пов'язані генетичні захворювання
натуральна віспа, osteonecrosis[1]
Реагує на сполуку
phenelzine[2]
Шаблон експресії
PBB GE CYP2C8 208147 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000770
NM_001198853
NM_001198854
NM_001198855
NM_030878
NM_010003
RefSeq (білок)
NP_000761
NP_001185782
NP_001185783
NP_001185784
NP_034133
Локус (UCSC) Хр. 10: 95.04 – 95.07 Mb Хр. 19: 39.51 – 39.57 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDI
CKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNS
PISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAH
CLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKR
FNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKE
HQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA
VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKE
FPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT
TILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Kimura S., Pastewka J., Gelboin H.V., Gonzalez F.J. (1987). cDNA and amino acid sequences of two members of the human P450IIC gene subfamily.. Nucleic Acids Res. 15: 10053 — 10054.  PubMed DOI:10.1093/nar/15.23.10053
  • Romkes M., Faletto M.B., Blaisdell J.A., Raucy J.L., Goldstein J.A. (1991). Cloning and expression of complementary DNAs for multiple members of the human cytochrome P450IIC subfamily.. Biochemistry 30: 3247 — 3255.  PubMed DOI:10.1021/bi00227a012
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ged C., Beaune P. (1991). Isolation of the human cytochrome P-450 IIC8 gene: multiple glucocorticoid responsive elements in the 5' region.. Biochim. Biophys. Acta 1088: 433 — 435.  PubMed DOI:10.1016/0167-4781(91)90138-C
  • Zeldin D.C., DuBois R.N., Falck J.R., Capdevila J.H. (1995). Molecular cloning, expression and characterization of an endogenous human cytochrome P450 arachidonic acid epoxygenase isoform.. Arch. Biochem. Biophys. 322: 76 — 86.  PubMed DOI:10.1006/abbi.1995.1438
  • Shephard E.A., Phillips I.R., Santisteban I., Palmer C.N., Povey S. (1989). Cloning, expression and chromosomal localization of a member of the human cytochrome P450IIC gene sub-family.. Ann. Hum. Genet. 53: 23 — 31.  PubMed DOI:10.1111/j.1469-1809.1989.tb01119.x

ПриміткиРедагувати

Див. такожРедагувати