Відкрити головне меню

CYP11A1 (англ. Cytochrome P450 family 11 subfamily A member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 521 амінокислот, а молекулярна маса — 60 102[6].

CYP11A1
3n9y.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CYP11A1, CYP11A, CYPXIA1, P450SCC, cytochrome P450 family 11 subfamily A member 1
Зовнішні ІД OMIM: 118485 MGI: 88582 HomoloGene: 37347 GeneCards: CYP11A1
Пов'язані генетичні захворювання
congenital adrenal insufficiency[1]
Реагує на сполуку
mitotane[2]
Шаблон експресії
PBB GE CYP11A1 204309 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001099773
NM_000781
NM_019779
NM_001346787
RefSeq (білок)
NP_000772
NP_001093243
NP_001333716
NP_062753
Локус (UCSC) Хр. 15: 74.34 – 74.37 Mb Хр. 9: 58.01 – 58.03 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNE
IPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVY
VIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD
RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNL
PPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG
ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD
MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVN
DLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF
RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLI
LMPEKPISFTFWPFNQEATQQ

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах, як метаболізм ліпідів, метаболізм холестеролу, метаболізм стероїдів, метаболізм стеролів, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у мембрані, мітохондрії.

ЛітератураРедагувати

  • Chung B.-C., Matteson K.J., Voutilainen R., Mohandas T.K., Miller W.L. (1986). Human cholesterol side-chain cleavage enzyme, P450scc: cDNA cloning, assignment of the gene to chromosome 15, and expression in the placenta.. Proc. Natl. Acad. Sci. U.S.A. 83: 8962 — 8966.  PubMed DOI:10.1073/pnas.83.23.8962
  • Morohashi K., Sogawa K., Omura T., Fujii-Kuriyama Y. (1987). Gene structure of human cytochrome P-450(SCC), cholesterol desmolase.. J. Biochem. 101: 879 — 887.  PubMed DOI:10.1093/oxfordjournals.jbchem.a121955
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hu M.C., Guo I.C., Lin J.H., Chung B.-C. (1991). Regulated expression of cytochrome P-450scc (cholesterol-side-chain cleavage enzyme) in cultured cell lines detected by antibody against bacterially expressed human protein.. Biochem. J. 274: 813 — 817.  PubMed DOI:10.1042/bj2740813
  • Matteson K.J., Chung B.-C., Urdea M.S., Miller W.L. (1986). Study of cholesterol side-chain cleavage (20,22 desmolase) deficiency causing congenital lipoid adrenal hyperplasia using bovine-sequence P450scc oligodeoxyribonucleotide probes.. Endocrinology 118: 1296 — 1305.  PubMed DOI:10.1210/endo-118-4-1296
  • Tajima T., Fujieda K., Kouda N., Nakae J., Miller W.L. (2001). Heterozygous mutation in the cholesterol side chain cleavage enzyme (P450scc) gene in a patient with 46,XY sex reversal and adrenal insufficiency.. J. Clin. Endocrinol. Metab. 86: 3820 — 3825.  PubMed DOI:10.1210/jcem.86.8.7748

ПриміткиРедагувати

Див. такожРедагувати