Відкрити головне меню

CXCL1 (англ. C-X-C motif chemokine ligand 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 107 амінокислот, а молекулярна маса — 11 301[4].

CXCL1
Protein CXCL1 PDB 1mgs.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1, C-X-C motif chemokine ligand 1
Зовнішні ІД OMIM: 155730 MGI: 3037818 HomoloGene: 136748 GeneCards: CXCL1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001511
NM_203320
RefSeq (білок)
NP_001502
NP_976065
Локус (UCSC) Хр. 4: 73.87 – 73.87 Mb Хр. 5: 90.79 – 90.79 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQ
GIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKM
LNSDKSN

Кодований геном білок за функціями належить до цитокінів, факторів росту. Задіяний у такому біологічному процесі як запальна відповідь. Секретований назовні.

ЛітератураРедагувати

  • Anisowicz A., Bardwell L., Sager R. (1987). Constitutive overexpression of a growth-regulated gene in transformed Chinese hamster and human cells.. Proc. Natl. Acad. Sci. U.S.A. 84: 7188 — 7192.  PubMed DOI:10.1073/pnas.84.20.7188
  • Baker N.E., Kucera G., Richmond A. (1990). Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene.. Nucleic Acids Res. 18: 6453 — 6453.  PubMed DOI:10.1093/nar/18.21.6453
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Schroeder J.-M., Persoon N.L.M., Christophers E. (1990). Lipopolysaccharide-stimulated human monocytes secrete, apart from neutrophil-activating peptide 1/interleukin 8, a second neutrophil-activating protein. NH2-terminal amino acid sequence identity with melanoma growth stimulatory activity.. J. Exp. Med. 171: 1091 — 1100.  PubMed DOI:10.1084/jem.171.4.1091
  • Golds E.E., Mason P., Nyirkos P. (1989). Inflammatory cytokines induce synthesis and secretion of gro protein and a neutrophil chemotactic factor but not beta 2-microglobulin in human synovial cells and fibroblasts.. Biochem. J. 259: 585 — 588.  PubMed DOI:10.1042/bj2590585
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4602 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P09341 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати