CSE1L

білок-кодуючий ген Homo Sapiens

CSE1L (англ. Chromosome segregation 1 like) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 971 амінокислот, а молекулярна маса — 110 417[4].

CSE1L
Ідентифікатори
Символи CSE1L, CAS, CSE1, XPO2, chromosome segregation 1 like
Зовнішні ІД OMIM: 601342 MGI: 1339951 HomoloGene: 1006 GeneCards: CSE1L
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001256135
NM_001316
NM_177436
NM_001362762
NM_023565
RefSeq (білок)
NP_001243064
NP_001307
NP_001349691
NP_076054
Локус (UCSC) Хр. 20: 49.05 – 49.1 Mb Хр. 2: 166.75 – 166.79 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLL
EKSQDNVIKVCASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLM
LSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQSGDFHVINGVL
RTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIELCSTHAN
DASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMNNFHTLLTLDN
KLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVP
NMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGP
VTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQKHGITQ
ANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHL
LVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLFTAAEIAPFV
EILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTE
ILQNDVQEFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGN
IPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKANDHQGFYL
LNSIIEHMPPESVDQYRKQIFILLFQRLQNSKTTKFIKSFLVFINLYCIK
YGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKKICAVGITKLL
TECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ
TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTS
LNAEALQYLQGYLQAASVTLL

Задіяний у таких біологічних процесах як транспорт, транспорт білків. Локалізований у цитоплазмі, ядрі.

ЛітератураРедагувати

  • Brinkmann U., Brinkmann E., Gallo M., Pastan I. (1995). Cloning and characterization of a cellular apoptosis susceptibility gene, the human homologue to the yeast chromosome segregation gene CSE1.. Proc. Natl. Acad. Sci. U.S.A. 92: 10427 — 10431.  PubMed DOI:10.1073/pnas.92.22.10427
  • Brinkmann U., Brinkmann E., Bera T.K., Wellmann A., Pastan I. (1999). Tissue-specific alternative splicing of the CSE1L/CAS (cellular apoptosis susceptibility) gene.. Genomics 58: 41 — 49.  PubMed DOI:10.1006/geno.1998.5700
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kutay U., Bischoff F.R., Kostka S., Kraft R., Goerlich D. (1997). Export of importin-alpha from the nucleus is mediated by a specific nuclear transport factor.. Cell 90: 1061 — 1071.  PubMed DOI:10.1016/S0092-8674(00)80372-4
  • Herold A., Truant R., Wiegand H., Cullen B.R. (1998). Determination of the functional domain organization of the importin alpha nuclear import factor.. J. Cell Biol. 143: 309 — 318.  PubMed DOI:10.1083/jcb.143.2.309

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2431 (англ.). Архів оригіналу за 2 липня 2017. Процитовано 21 серпня 2017. 
  4. UniProt, P55060 (англ.). Архів оригіналу за 30 серпня 2017. Процитовано 21 серпня 2017. 

Див. такожРедагувати