Відкрити головне меню

CRY1 (англ. Cryptochrome circadian clock 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 586 амінокислот, а молекулярна маса — 66 395[5].

CRY1
CRY1Pretty.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CRY1, cryptochrome circadian clock 1, PHLL1, DSPD, cryptochrome circadian regulator 1
Зовнішні ІД OMIM: 601933 MGI: 1270841 HomoloGene: 7042 GeneCards: CRY1
Пов'язані генетичні захворювання
Безсоння[1]
Шаблон експресії
PBB GE CRY1 209674 at fs.png

PBB GE CRY2 212695 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004075
NM_007771
RefSeq (білок)
NP_004066
NP_004066.1
NP_031797
Локус (UCSC) Хр. 12: 106.99 – 107.09 Mb Хр. 10: 85.13 – 85.19 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGIN
RWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEY
DSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTY
KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
DTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTG
LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE
GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWL
SCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNA
PEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLL
ASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLL
KQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN

Кодований геном білок за функціями належить до репресорів, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з нуклеотидами, хромофором, ФАД, флавопротеїном. Локалізований у цитоплазмі, ядрі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Griffin E.A. Jr., Staknis D., Weitz C.J. (1999). Light-independent role of CRY1 and CRY2 in the mammalian circadian clock.. Science 286: 768 — 771.  PubMed DOI:10.1126/science.286.5440.768
  • Partch C.L., Shields K.F., Thompson C.L., Selby C.P., Sancar A. (2006). Posttranslational regulation of the mammalian circadian clock by cryptochrome and protein phosphatase 5.. Proc. Natl. Acad. Sci. U.S.A. 103: 10467 — 10472.  PubMed DOI:10.1073/pnas.0604138103
  • Ye R., Selby C.P., Ozturk N., Annayev Y., Sancar A. (2011). Biochemical analysis of the canonical model for the mammalian circadian clock.. J. Biol. Chem. 286: 25891 — 25902.  PubMed DOI:10.1074/jbc.M111.254680
  • Eckel-Mahan K., Sassone-Corsi P. (2013). Metabolism and the circadian clock converge.. Physiol. Rev. 93: 107 — 135.  PubMed DOI:10.1152/physrev.00016.2012
  • Partch C.L., Green C.B., Takahashi J.S. (2014). Molecular architecture of the mammalian circadian clock.. Trends Cell Biol. 24: 90 — 99.  PubMed DOI:10.1016/j.tcb.2013.07.002

ПриміткиРедагувати

Див. такожРедагувати