Відкрити головне меню

CLCN3 (англ. Chloride voltage-gated channel 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 818 амінокислот, а молекулярна маса — 90 966[5].

CLCN3
Ідентифікатори
Символи CLCN3, CLC3, ClC-3, chloride voltage-gated channel 3
Зовнішні ІД OMIM: 600580 MGI: 103555 HomoloGene: 20435 GeneCards: CLCN3
Реагує на сполуку
phloretin[1]
Шаблон експресії
PBB GE CLCN3 201732 s at fs.png

PBB GE CLCN3 201733 at fs.png

PBB GE CLCN3 201734 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243372
NM_001243374
NM_001829
NM_173872
NM_007711
NM_173873
NM_173874
NM_173876
RefSeq (білок)
NP_001230301
NP_001230303
NP_001820
NP_776297
NP_031737
NP_776298
NP_776299
NP_776301
Локус (UCSC) Хр. 4: 169.61 – 169.72 Mb Хр. 8: 60.91 – 60.98 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD
TAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKD
RERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASGALAGLIDIAA
DWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQ
AEGPGSYIMNYIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSG
FIIRGYLGKWTLMIKTITLVLAVASGLSLGKEGPLVHVACCCGNIFSYLF
PKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLW
RSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFG
GLWGAFFIRANIAWCRRRKSTKFGKYPVLEVIIVAAITAVIAFPNPYTRL
NTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDRPAGIGVYSAI
WQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAY
YHHDWFIFKEWCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFEL
TGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTH
TTLAADVMRPRRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKES
QRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLK
LRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDI
LRHMAQTANQDPASIMFN

Задіяний у таких біологічних процесах як транспорт іонів, транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, хлоридом. Локалізований у мембрані, цитоплазматичних везикулах, апараті гольджі, ендосомах.

ЛітератураРедагувати

  • Borsani G., Rugarli E.I., Taglialatela M., Wong C., Ballabio A. (1995). Characterization of a human and murine gene (CLCN3) sharing similarities to voltage-gated chloride channels and to a yeast integral membrane protein.. Genomics 27: 131 — 141.  PubMed DOI:10.1006/geno.1995.1015
  • Shepard A.R., Rae J.L. (1998). Ion transporters and receptors in cDNA libraries from lens and cornea epithelia.. Curr. Eye Res. 17: 708 — 719.  PubMed DOI:10.1080/02713689808951247
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

Див. такожРедагувати