Відкрити головне меню

CDKN1C (англ. Cyclin dependent kinase inhibitor 1C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 316 амінокислот, а молекулярна маса — 32 177[3].

CDKN1C
Ідентифікатори
Символи CDKN1C, BWCR, BWS, KIP2, WBS, p57, p57Kip2, cyclin-dependent kinase inhibitor 1C, cyclin dependent kinase inhibitor 1C
Зовнішні ІД HomoloGene: 133549 GeneCards: CDKN1C
Шаблон експресії
PBB GE CDKN1C 213182 x at fs.png

PBB GE CDKN1C 213348 at fs.png

PBB GE CDKN1C 216894 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000076
NM_001122630
NM_001122631
NM_001362474
NM_001362475
н/д
RefSeq (білок)
NP_000067
NP_001116102
NP_001116103
NP_001349403
NP_001349404
н/д
Локус (UCSC) Хр. 11: 2.88 – 2.89 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARL
AELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
RLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPP
VPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAP
APAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRP
AAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA
APGVGSVEQTPRKRLR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, альтернативний сплайсинг. Локалізований у ядрі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:1786 (англ.). Процитовано 8 вересня 2017. 
  3. UniProt, P49918 (англ.). Процитовано 8 вересня 2017. 

Див. такожРедагувати