Відкрити головне меню

CD86 (англ. CD86 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 329 амінокислот, а молекулярна маса — 37 682[2].

CD86
Ідентифікатори
Символи CD86BU63B70T-lymphocyte activation antigen CD86CD86 antigen (CD28 antigen ligand 2B7-2 antigen)Activation B7-2 antigenFUN-1B-lymphocyte activation antigen B7-2CTLA-4 counter-receptor B7.2
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE CD86 205686 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSL
SELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNL
QIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITEN
VYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVS
ISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWIT
AVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу віруса, рецепторів. Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет, взаємодія хазяїн-вірус, поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Short J.J., Vasu C., Holterman M.J., Curiel D.T., Pereboev A. (2006). Members of adenovirus species B utilize CD80 and CD86 as cellular attachment receptors.. Virus Res. 122: 144 — 153.  PubMed DOI:10.1016/j.virusres.2006.07.009
  • Schwartz J.C., Zhang X., Fedorov A.A., Nathenson S.G., Almo S.C. (2001). Structural basis for co-stimulation by the human CTLA-4/B7-2 complex.. Nature 410: 604 — 608.  PubMed DOI:10.1038/35069112
  • Zhang X., Schwartz J.C., Almo S.C., Nathenson S.G. (2003). Crystal structure of the receptor-binding domain of human B7-2: insights into organization and signaling.. Proc. Natl. Acad. Sci. U.S.A. 100: 2586 — 2591.  PubMed DOI:10.1073/pnas.252771499

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:1705 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P42081 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати